Key Figures

A comprehensive, ever-growing directory of every person connected to the UFO/UAP phenomenon — government officials, scientists, witnesses, researchers, whistleblowers, and more. Updated with every case file.

Loading...

No figures found

Try a different search term or clear the filter.

🎖️

Government & Military Officials

324
AL
1915 – 1992
Senior Photo-Intelligence Officer; Founding Director, CIA National Photographic Interpretation Center
One of the U.S. government's most senior photo-interpretation specialists, Lundahl reviewed and endorsed the U.S. Naval Photographic Interpretation Laboratory's roughly 1,000-man-hour frame-by-frame analysis of the July 1952 Tremonton, Utah UFO film, which concluded the objects were not birds, balloons, or aircraft. Within a few years of that review, Lundahl became the founding director of the CIA's National Photographic Interpretation Center, later playing a central role in photo-analysis of the 1962 Cuban Missile Crisis.
AN
fl. 1978 – 1979
Brigadiere, Carabinieri, Torriglia Station Commander
Led the official Carabinieri investigation into Pier Fortunato Zanfretta's December 1978 encounter, personally collecting 52 independent witness statements describing an unidentified light over Torriglia the same night. Filed a formal report with the Genoa Pretura on January 3, 1979 rating the case's overall credibility "buono" (good). Decades later, in a 2007 television appearance, Nucchi himself claimed to have personally witnessed a UFO during the original inquiry.
Former Italian Navy Admiral; Deputy, Parliamentary Defense Commission
A former admiral turned Socialist Deputy, Accame filed a formal parliamentary interrogation in early 1979 pressing Defense Minister Attilio Ruffini and Prime Minister Giulio Andreotti for an official government accounting of Italy's record 1978 UFO wave, the same national wave that produced the Zanfretta case at Torriglia.
Former Chief, U.S. Navy Guided Missile Program; Acting Director, NICAP (1957)
Retired Navy rear admiral recruited by T. Townsend Brown to NICAP's founding board in October 1956 for his institutional credibility. Served as acting director after Brown's removal in January 1957, publicly stating at a January 16, 1957 press conference that NICAP considered UFOs real and under intelligent control, before resigning that April for personal reasons.
DR
fl. 1948 – 1949
Colonel, Commanding Officer, 17th District, Air Force Office of Special Investigations, Kirtland AFB
The military intelligence officer most directly responsible for compiling and escalating the 1948–49 New Mexico green fireball reports. Rees organized incoming sightings into three working categories — the green fireball phenomenon, discs and variants, and other unknowns — and forwarded a formal categorized summary to Brigadier General Joseph F. Carroll, USAF Director of Special Investigations, turning scattered pilot reports into a matter for the nation's top nuclear-security officials.
JC
1910 – 1991
Brigadier General, First Commander, U.S. Air Force Office of Special Investigations
Loaned to the newly independent Air Force by FBI Director J. Edgar Hoover in 1947 to organize its investigative and counterintelligence arm along FBI lines, Carroll became the founding commander of the Air Force Office of Special Investigations in 1948 and, in 1961, the founding director of the Defense Intelligence Agency. In 1949, Colonel Doyle Rees's Kirtland-based summaries of the green fireball sightings were transmitted up the chain to Carroll, placing the case within the same command responsible for counterintelligence at the nation's most classified atomic-weapons installations.
ER
Former First Lady; U.S. Delegate to the United Nations; Host, "Today with Mrs. Roosevelt" (NBC)
By 1950 a sitting U.S. delegate to the UN General Assembly and chair of its Commission on Human Rights, Roosevelt was five weeks into hosting her own NBC television program when she read a United Press wire story about Capt. Jack Adams and First Officer G.W. Anderson Jr.'s Arkansas sighting. She had the two pilots, and a hastily built model of the object, in her New York studio within about a week. The episode later led her to write directly to physicist J. Robert Oppenheimer in May 1950 asking his opinion of the flying-saucer phenomenon, a letter preserved in the Oppenheimer Papers at the Library of Congress.
CC
1903 – 1971
Major General, Director of Air Force Intelligence
As the Air Force's director of intelligence, Cabell had established Project Grudge in 1949 to study UFO reports. When press coverage of the September 1951 Fort Monmouth radar-visual case reached his office in late September, he learned Grudge had become effectively inactive and ordered an immediate field investigation with "Operational Immediate" priority. His subsequent Pentagon meeting on October 1, 1951 — at which Lt. Jerry Cummings candidly described Grudge's dysfunction — led directly to the project's reorganization, the reassignment of several ATIC officers, and Edward J. Ruppelt's appointment to head what would be renamed Project Blue Book by March 1952. Cabell went on to become deputy director of the CIA from 1953 to 1962.
Chief, Aircraft and Missiles Branch, Air Technical Intelligence Center
Head of ATIC's aircraft and missiles branch, Rosengarten traveled to Fort Monmouth with Lt. Jerry Cummings from September 28 to October 2, 1951, personally interrogating PFC Eugene A. Clark, Lt. Wilbert S. Rogers, Maj. Edward Ballard Jr., and other radar and weather personnel, and filed the resulting investigation report on October 16, 1951. He later recalled the October 1 Pentagon meeting with Gen. Cabell as comparatively low-key, focused chiefly on press coverage of UFOs — a recollection that differs somewhat from Edward J. Ruppelt's own more dramatic published account of visibly angry generals and colonels.
JC
Air Technical Intelligence Center Officer, Project Grudge
Co-investigated the Fort Monmouth case alongside Lt. Col. N.R. Rosengarten in late September 1951, then briefed Gen. Charles P. Cabell directly at the Pentagon on October 1, candidly describing how Project Grudge's UFO reports had been treated dismissively and its analysis reduced to manufacturing explanations rather than genuine investigation. That briefing is credited, in Edward J. Ruppelt's own account, with triggering Cabell's order to reorganize the project — a reorganization that led to Ruppelt's own appointment and, by March 1952, the creation of Project Blue Book.
HM
fl. 1951 – 1953
Air Technical Intelligence Center Engineer
A trusted engineering colleague of Edward J. Ruppelt's at ATIC, Metscher developed the analysis attributing the Fort Monmouth case's T-33 sighting to one of two balloons released from Evans Signal Laboratory at 11:12 a.m. on September 10, 1951, arguing that the balloon's line-of-sight relative motion against the jet could account for the pilots' reported maneuvers. Ruppelt relied on Metscher's analysis for a November 30, 1951 status report to the Pentagon, though the pilots themselves rejected it, and later researcher Brad Sparks has raised specific technical objections to it.
JS
1904 – 1968
Director of Air Force Intelligence (1952–1956)
USAF Major General who led the July 29, 1952 Pentagon press conference on the Washington, D.C. radar sightings — the largest Pentagon briefing since World War II. Publicly offered temperature inversion as an explanation while candidly admitting under direct questioning that he could not explain the Pierman radar-visual correlation. Later served as Director of the National Security Agency (1956–1960).
ER
1923 – 1960
Head, Project Blue Book (1951–1953)
USAF officer who reorganized Project Grudge into Project Blue Book in March 1952 and led it through the July 1952 Washington flap, coining the term "Unidentified Flying Object" to replace the more sensational "flying saucer." Fielded President Truman's inquiry via aide Robert Landry and stood at the Pentagon podium beside Samford. His 1956 book, The Report on Unidentified Flying Objects, documented his private doubts about the temperature-inversion explanation he had originally suggested as a hunch. In July 1952 he personally arranged a second Air Force review of Nick Mariana's Great Falls, Montana film and concluded the jets originally blamed for it "weren't anywhere close to where the two UFOs had been," reclassifying the case an unknown. Also personally documented the June 1952 F-47 pursuit of a radar-tracked light near Oak Ridge, Tennessee.
Investigating Engineer, GEPAN; later Head, SEPRA, CNES (France)
Engineer with GEPAN, the government UAP study unit inside CNES, France's national space agency, who led the detailed on-site investigation of the Trans-en-Provence landing on February 17, 1981, documenting the ground trace and coordinating multi-laboratory sample analysis. Managed the case through its 1983 publication and later English-language 1990 Journal of Scientific Exploration paper, and went on to head GEPAN's successor agency, SEPRA, later in the 1980s — one of the very few career government officials in the world whose job was the direct scientific investigation of UFO reports.
CP
Founder, GEPAN, CNES (France), 1977
CNES engineer who, with the approval of then-director general Yves Sillard, established GEPAN (Groupe d'Etudes des Phénomènes Aérospatiaux Non-identifiés) in 1977 as a formal technical unit within France's national space agency, tasked with scientifically investigating UAP reports referred through the national gendarmerie. GEPAN's mandate — and its later willingness to commission real multi-laboratory analysis of physical evidence — directly enabled the Trans-en-Provence investigation four years later, and set the template later carried forward by SEPRA and GEIPAN. In April 1978, Poher personally led a four-person team back to Cussac, Cantal to reconstruct the plateau's decade-old 1967 close encounter, concluding the child witnesses' testimony showed no basis for suspecting hoax or hallucination; he continued defending that finding against a rival helicopter-misidentification hypothesis into the 2000s.
GK
1930 – 2001
First Chief Minister, New Hebrides (1978–1978)
A moderate, francophone-aligned New Hebridean political figure and former policeman who became the territory's first Chief Minister when the New Hebrides became internally self-governing in January 1978, five months before the Port Vila Fishermen's Sighting occurred in his territory's capital. He held the post through most of 1978, presiding over a Representative Assembly divided between francophone and anglophone factions, before losing a confidence vote in December 1978 and being succeeded by Gérard Leymang's Government of National Unity.
GL
1937 – 2002
Chief Minister, New Hebrides (December 1978–1979)
A Roman Catholic priest and francophone political leader who succeeded George Kalsakau as Chief Minister of the New Hebrides in December 1978, six months after the Port Vila Fishermen's Sighting, forming a Government of National Unity that included the anglophone Vanua'aku Pati under Walter Lini in an effort to bridge the territory's francophone-anglophone divide ahead of independence.
WL
1942 – 1999
Deputy Chief Minister, New Hebrides (1978–1980); later first Prime Minister of independent Vanuatu
An Anglican priest and anglophone, pro-independence political leader who headed the Vanua'aku Pati and served as Deputy Chief Minister under Gérard Leymang's Government of National Unity, formed in the New Hebrides in December 1978, six months after the Port Vila Fishermen's Sighting. He went on to become the first Prime Minister of independent Vanuatu upon its formation in July 1980.
WP
F-94C Starfire Interceptor Pilot, Delaware Air National Guard
Wingman on the July 26–27, 1952 intercept scramble from New Castle Air Force Base. Reported four white glows surrounding his aircraft and could not close the distance despite flying at maximum speed — the sighting that anchored General Samford's Pentagon press conference three days later.
JM
active 1952
F-94 Flight Leader, Delaware Air National Guard
Led both New Castle AFB interceptor scrambles during the Washington flap. Repeatedly vectored toward radar contacts, he personally saw nothing on either night — a notable contrast to wingman William Patterson's sighting during the same intercepts.
WB
active 1952
Airman, Control Tower, Andrews Air Force Base
Independently observed an orange fireball trailing a tail from the Andrews AFB tower on July 19–20, 1952, describing it as "unlike anything I had ever seen before."
CD
Staff Sergeant, Andrews Air Force Base
Watched an orange-red light make abrupt changes in altitude and direction from ground level at Andrews AFB, corroborating Airman William Brady's simultaneous tower sighting.
CC
Master Sergeant, Andrews Air Force Base
Witnessed unexplained lights during the 1952 Washington flap and explicitly ruled out the most obvious mundane explanation: "These lights did not have the characteristics of shooting stars…They traveled faster than any shooting star I have ever seen."
RL
active 1952
Brigadier General, Air Force Aide to President Truman
Truman's Air Force aide, who periodically briefed the president on UFO matters starting in 1948. Telephoned Capt. Edward Ruppelt on July 27, 1952 for an explanation of the Washington radar returns while Truman listened silently on a second line.
HT
1884 – 1972
33rd President of the United States (1945–1953)
Personally requested an explanation for the July 1952 Washington radar sightings through his Air Force aide, Brig. Gen. Robert Landry, listening silently as Landry questioned Capt. Edward Ruppelt by telephone. His administration's concern over the sightings is credited with accelerating the Pentagon's July 29 press conference.
AD
1893 – 1969
Director of Central Intelligence (1953–1961)
Oversaw the CIA during peak Cold War UFO activity, including the Robertson Panel (1953) which recommended debunking UFOs. Managed Operation Paperclip, bringing Nazi scientists to the U.S. His tenure coincided with the establishment of alleged crash-retrieval programs referenced in MJ-12 documents.
CIA Operation Paperclip MJ-12 Roswell
HM
1935 – 2025
Senior diplomat, Presidential advisor (JFK, LBJ, Nixon, Ford)
Claimed he possessed "Q" clearances in the 1960s giving access to UFO-related material. Alleged that in 1962, following the Bluegill Triple Prime nuclear test, he was given physical debris from a non-human craft by Lawrence Preston Gise of the Atomic Energy Commission. Also claimed briefings by CIA Deputy Director Richard Bissell on "otherworld technologies" and past crash retrievals.
AEC DOE Crash Retrieval Pippa Malmgren
PM
Economist, former Special Assistant to President G.W. Bush
Daughter of Harold Malmgren. Has spoken publicly about UAP within a geopolitical and national security framework, noting the shift from denial to "disclosure and discovery." Has speculated on government efforts to bring classified "otherworld" technologies into the public domain. Her father reportedly shared his UAP-related insider knowledge with her.
White House Harold Malmgren
TG
Rear Admiral, USN (Ret.); former Acting Administrator of NOAA
One of the most senior military officers to publicly advocate for UAP transparency. Testified before Congress in November 2024, describing a 2015 incident where a UAP-related email vanished from his secure Navy inbox. Has stated non-human intelligence behind UAP is "absolutely real." Affiliated with SOL Foundation, Galileo Project, and Americans for Safe Aerospace.
SOL Foundation Galileo Project Karl Nell Garry Nolan
KN
b. ~1968
Colonel, USA (Ret.); aerospace executive; Army liaison to UAPTF
At the 2024 SALT conference, declared there is "zero doubt" that non-human intelligent life has visited Earth — an unprecedented public statement from a senior military officer. Presented a phased "campaign plan" for UAP disclosure at the SOL Foundation. Publicly vouched for the credibility of whistleblower David Grusch. Warned that uncontrolled disclosure could have "catastrophic" societal consequences.
SOL Foundation UAPTF David Grusch Tim Gallaudet
RS
b. ~1942
1st Lieutenant, USAF (Ret.); deputy missile combat crew commander
A 1964 U.S. Air Force Academy graduate, Salas was deputy commander of the missile combat crew on duty at Malmstrom AFB's Oscar Flight launch control facility on March 24, 1967, under crew commander Fred Meiwald, when security guards reported a glowing red/orange oval object hovering over the facility gate and ten Minuteman I ICBMs under his command dropped into "No-Go" status. A similar shutdown had struck Echo Flight, another of Malmstrom's missile flights, eight days earlier. Salas resigned his commission in 1971, later earned a graduate degree in aerospace engineering, worked for the FAA, and taught mathematics before becoming one of the most prominent on-the-record military witnesses in the UAP-nuclear research field, co-authoring Faded Giant (2005) and testifying publicly for decades, including at the 2010 and 2021 National Press Club events. See the full Malmstrom AFB case file for the complete, independently sourced chronology.
FM
b. ~1938
Captain, USAF (later Colonel, Ret.); Oscar Flight crew commander
Commanded the missile combat crew on duty at Malmstrom AFB's Oscar Flight on March 24, 1967, with Robert Salas as his deputy. In a 2011 taped interview with Robert Hastings, Meiwald confirmed that a Security Alert Team he dispatched to investigate an intrusion alarm reported "a bright object; a bright, flying object at low-level," and that at least one guard was too shaken to finish his shift. He said he could not personally corroborate the specific red oval object Salas described at the front gate, having been resting when the first missiles dropped off alert, and that both he and Salas were debriefed and required to sign national-security non-disclosure statements afterward.
WF
b. ~1940
1st Lieutenant, USAF (later Colonel, Ret.); Echo Flight deputy crew commander
Deputy commander of the missile combat crew on duty at Malmstrom AFB's Echo Flight on March 16, 1967, alongside crew commander Eric Carlson, when all ten of the flight's Minuteman I missiles dropped to "No-Go" status. In audiotaped interviews with Hastings and Salas, Figel described a security guard reporting "a large round object" hovering over one of the launch facilities immediately before the malfunction, and Security Alert Teams independently describing the same object without being told what to look for. In later statements to his son's researcher, Figel and Carlson disputed that any UFO was involved — a contradiction this file treats as a genuinely unresolved part of the case's record rather than resolving it in either direction.
EC
b. ~1937
Captain, USAF (Ret.); Echo Flight crew commander
Commanded the missile combat crew on duty at Malmstrom AFB's Echo Flight on March 16, 1967, with Walt Figel as his deputy. Carlson has told researchers, including his son James Carlson, that he does not recall any UFO reports or related debriefing connected to the incident. Figel has separately maintained that Carlson was "sitting right there, two feet away" during radio traffic describing the object, a direct conflict between the two officers who shared the same underground capsule that morning.
RK
Lead engineer, Boeing Company missile systems investigation team
Led the Boeing engineering team, working with the Air Force's Oklahoma City Air Materiel Area and the 15th Air Force, that investigated the March 16, 1967 Echo Flight shutdown for the classified "Report of Engineering Investigation of Echo Flight Incident." Kaminski stated on the record that "there were no significant failures, engineering data or findings that would explain how ten missiles were knocked off alert," and separately acknowledged learning that airmen had reported UFO sightings during the incident, even though his own engineering mandate was limited to the hardware.
HW
Mayor of Wanaque, New Jersey
Wanaque's sitting mayor on the night of January 11, 1966, when he drove to a sandpit near the Raymond Dam with his young son and watched a silent, color-shifting object hover over the frozen Wanaque Reservoir alongside three of his own councilmen. Wolfe went on record with reporters describing the event as "terribly strange," lending the case an unusual degree of institutional credibility for a small-town nocturnal-light sighting.
DS
fl. 1966
Sergeant, Wanaque Police Department
One of the first officers on scene at the Raymond Dam on January 11, 1966, Sisco watched a cylinder-shaped object move with a "rocking chair" motion before accelerating straight upward. He saw the object again the following evening, describing it gliding and then "streaking faster than a jet."
GD
Officer, Wanaque Police Department
Present among the police witnesses during the January 11, 1966 sighting over the Wanaque Reservoir, Dykman told reporters afterward, "I've never seen anything like it in my life," adding independent police corroboration to the civilian and municipal-official testimony gathered that evening.
JW
fl. 1966
Patrolman, Wanaque Police Department
Sighted a "bright white disk," disc-shaped and egg-shaped depending on angle, near Lilly Mountain on January 12, 1966, extending the flap to a second consecutive night. Remained one of the case's most publicly vocal defenders in later years, dismissing the Air Force's helicopter explanation: "If you can't discern a helicopter or hear one, you have to be pretty bad off."
BT
fl. 1966
Sergeant, Wanaque Reservoir Police
A six-year veteran of the reservoir police force, Thompson was alone on patrol near Cooper's Swamp on October 10, 1966 when he watched an erratically moving, extremely bright object at close range before it fled when he activated his patrol car's dome light. Per a later account from colleague Charles Theodora, Thompson was among the officers reportedly told by superiors to stop discussing the sightings after a visit from an unidentified Air Force officer.
BS
Civil Defense Director, Wanaque, New Jersey
As the borough's civil defense director, Spencer's professional role required him to assess unusual aerial activity as a matter of routine duty. He was among the group at the Raymond Dam sandpit on January 11, 1966 and independently described a bolt of light shooting down toward the reservoir's ice.
CT
Reservoir Guard; former Wanaque Police Officer
A former sworn Wanaque policeman working reservoir security, Theodora was among the first witnesses at the Wanaque Reservoir dam on January 11, 1966 and reported seeing the object on at least three separate occasions across the year. Decades later, in interviews with researcher Anthony Bragalia, Theodora described personally photographing the object and having the photograph confiscated by his police chief as "government property," along with an alleged post-sighting meeting with an unnamed Air Force officer.
Police Officer, Pompton Lakes, New Jersey
Off duty at home on October 10, 1966, Gordon, his wife, and a neighbor independently observed a bright object matching descriptions given by Sgt. Ben Thompson the same night in neighboring Wanaque, providing cross-jurisdictional corroboration from a separate municipal department.
LC
fl. 1967
Lieutenant Colonel, USAF; Project Blue Book field investigator
Investigated both the Belt, Montana landing report and, separately, the Echo Flight missile shutdown for Project Blue Book in the spring of 1967. His report on the Belt sighting concluded with "negative results" after a daylight search of the site. When Condon Committee investigator Roy Craig asked him about the Echo Flight incident, Chase reportedly told him "I can't talk about that," citing classification.
Malmstrom AFB Project Blue Book
TP
Contemporary
Deputy Director, All-domain Anomaly Resolution Office (AARO)
Stated publicly that AARO determined a "cascading transformer failure" triggered by an "electrical storm," not UAP activity, caused the March 1967 Malmstrom shutdown, and that AARO found no UAP-related entries in nearby airfield or radar logs. Researchers including Robert Hastings have pointed out that the declassified 341st Strategic Missile Wing unit history directly contradicts this account — it states weather was ruled out as a factor and that the one documented transformer fault occurred roughly six hours after the shutdown began.
DF
Commander, USN (Ret.); lead pilot of the USS Nimitz Tic Tac encounter
Witnessed the most well-documented military UAP case in history on November 14, 2004. Described a 40-foot white "Tic Tac" craft with no wings, no exhaust, and performance far exceeding known technology. His account is corroborated by radar, FLIR, and multiple witnesses. Testified before Congress in 2023. His Lex Fridman and Joe Rogan interviews are among the most viewed UAP content on YouTube.
Tic Tac Five Observables Congressional Testimony Ryan Graves
RG
b. ~1988
Lieutenant, USN (Ret.); founder, Americans for Safe Aerospace
Witnessed UAP almost daily during F/A-18F training operations off the U.S. East Coast (2014–2015), including the broader radar/infrared wave that produced the "Gimbal" and "GoFast" videos. Founded Americans for Safe Aerospace to create pilot reporting mechanisms. Testified before Congress in 2023 alongside Fravor and Grusch. His flight-safety angle has been critical for legitimizing the UAP conversation.
CM
Former Deputy Assistant Secretary of Defense for Intelligence; National Security Affairs Advisor, TTSA
Career Pentagon intelligence official who obtained copies of the Gimbal, GoFast, and Nimitz videos and provided them to both The New York Times and To The Stars Academy of Arts & Science, setting in motion the chain of events that led to the Pentagon's official April 2020 declassification. Has framed his actions as a deliberate push for institutional transparency on a subject he believed was being reflexively stigmatized rather than seriously investigated.
Retired CIA Officer; Founding Technical Lead, Project PALLADIUM
Retired Central Intelligence Agency officer and electronic-warfare pioneer who led Project PALLADIUM, a Cold War program that launched balloon-borne metallic-sphere radar targets from a U.S. Navy submarine off Cuba to test Soviet radar detection capability. When asked by The War Zone in 2019 whether these devices resembled the Navy pilots' "cube in a sphere" reports off Virginia, Poteat confirmed the visual similarity was "interesting" but cautioned that the PALLADIUM spheres were built to test detection thresholds, not to simulate or spoof UFOs specifically.
TB
Retired EG&G Special Projects Radar Engineer, Area 51/Groom Lake; Founder, Roadrunners Internationale
Cold War-era radar cross-section engineer who worked on classified aircraft testing programs at Groom Lake (Area 51), later founding Roadrunners Internationale, an association of Area 51 program veterans. Interviewed by The War Zone alongside Gene Poteat in 2019 on the Navy's "cube in a sphere" reports, Barnes suggested the encounters resembled classified aerospace flight-testing of the kind he personally witnessed decades earlier, remarking that "we are doing it again."
VFA-11 "Cube-in-Sphere" Encounter Area 51 / Groom Lake
DG
b. ~1987
Former intelligence officer (NGA/NRO); UAP whistleblower
The most significant UAP whistleblower in history. In 2023, filed a complaint with the Intelligence Community Inspector General and testified before Congress that the U.S. government operates a crash-retrieval and reverse-engineering program for non-human craft. His testimony references Roswell-era programs and catalyzed unprecedented UAP legislation.
NGA NRO Congressional Testimony Grusch File
LE
Former director, AATIP (Pentagon UAP program)
Directed the Pentagon's Advanced Aerospace Threat Identification Program. Resigned in 2017 in protest over excessive secrecy and joined TTSA, facilitating the release of the Gimbal, GoFast, and FLIR1 Navy UAP videos. Coined the "Five Observables" framework. Author of Imminent (2024). Single-handedly transformed the UAP conversation from fringe to mainstream national security.
PC
1915 – 1998
Lt. Colonel, USA (Ret.); NSC staff under Eisenhower
Author of The Day After Roswell (1997), claiming that as head of the Foreign Technology desk at Army R&D, he personally seeded technology recovered from the Roswell crash into American industry — including integrated circuits, fiber optics, and Kevlar. His military credentials are verified; his extraordinary claims remain unconfirmed.
Roswell Reverse Engineering Army R&D
JM
Jesse Marcel Sr.
1907 – 1986
Major, USAAF; intelligence officer, 509th Bomb Group
First military official to investigate the Roswell debris in 1947. Showed debris to his family on his kitchen floor before it was flown to Fort Worth. In 1978, told Stanton Friedman the weather balloon was a cover story and the debris was "not of this earth" — single-handedly reviving the Roswell case after 31 years of silence.
Roswell 509th Bomb Group Stanton Friedman
WB
Base Commander, Roswell Army Air Field; 509th Bombardment Group
Commanded the only nuclear-armed unit when the 1947 crash occurred. Ordered Walter Haut to issue the 'flying disc' press release. Rather than being reprimanded, was promoted to four-star general and Vice Chief of Staff of the USAF. Two and a half years earlier, as commander of the 40th Bombardment Group's B-29s in the China-Burma-India theater from August 1944, he served within the same organizational structure and general period in which Pacific "ball of fire" sightings were being logged by XX Bomber Command crews — part of the wartime "foo fighters" phenomenon.
RR
1903 – 1963
Commander, Eighth Air Force, Fort Worth AAF
Orchestrated the retraction of the 'flying disc' press release. Photographed with substituted balloon wreckage containing the famous 'Ramey Memo.' Multiple witnesses stated the displayed material was not the actual crash debris.
Roswell Ramey Memo Cover-up
TD
1901 – 1992
Chief of Staff to General Ramey, Fort Worth AAF
Present in Ramey office photographs. In a 1991 signed affidavit, confirmed the weather balloon story was a cover ordered by General McMullen at the Pentagon. The real debris was flown to Washington under armed guard.
Roswell Cover-up Pentagon
WH
1922 – 2005
Public Information Officer, Roswell Army Air Field
Issued the July 8, 1947 'flying disc' press release. In a sealed affidavit signed 2002 (opened after his death), claimed Colonel Blanchard showed him an egg-shaped craft and bodies in Building 84. Co-founded the International UFO Museum.
Roswell Sealed Affidavit UFO Museum
SC
~1915 – 1999
Counter-Intelligence Corps Agent, RAAF
Accompanied Jesse Marcel to the Foster Ranch crash site. His testimony is the most contradictory: initially denied being at Roswell, then told Air Force investigators in 1994 he immediately recognized the material as a weather balloon.
Roswell CIC Debris Recovery
PS
1918 – 1995
Colonel, Base Adjutant, RAAF (509th Bomb Group)
Served as Base Adjutant during the Roswell recovery, managing all manifests and flight logs. Admitted to erasing and changing manifests to cover up flights carrying debris. Left handwritten margin notes in a book confirming the cover-up, stating "We found them, and the book is mostly true."
Roswell 509th Bomb Group Cover-up
CM
1892 – 1959
Deputy Commander, Strategic Air Command
Per DuBose's sworn affidavit, telephoned from the Pentagon and ordered debris shipped to Washington under armed guard. Also ordered the weather balloon cover story. Directed debris forwarded to Wright Field for analysis.
Roswell Pentagon Wright-Patterson
AE
1916 – 2005
Commander, Wright-Patterson AFB (1964–1966)
Stated he had personal knowledge of Roswell crash materials being delivered to Wright Field for analysis. Referenced an 'unholy thirteen' oversight committee controlling access. A combat veteran and base commander — highly credible by military standards.
Roswell Wright-Patterson MJ-12
SS
1947 – 1998
U.S. Representative, New Mexico (R)
Initiated the GAO investigation into Roswell in 1993–94. The resulting 1995 report found all outgoing messages from RAAF for 1945–1949 were destroyed without authorization. First member of Congress to formally pursue Roswell transparency.
Roswell GAO Congressional Oversight
IN
active 1947
Weather Officer, Fort Worth AAF
Summoned by General Ramey to identify debris. Immediately recognized it as a standard ML-307 RAWIN weather balloon with radar reflector. His identification provided technical authority for the 'weather balloon' retraction.
Roswell Weather Balloon Fort Worth
FS
Governor of Arizona (1991–1997); USAF Captain
Held a mock press conference in 1997 ridiculing the Phoenix Lights, but reversed his stance in 2007, admitting he personally witnessed the V-shaped craft. As a pilot and former Air Force officer, he stated the craft was enormous and "otherworldly."
AD
Lt. Commander, USN (Ret.); fighter pilot
Flew the wingman F/A-18F Super Hornet during the 2004 Nimitz intercept, visually corroborating Fravor's dogfight with the Tic Tac. Testified before Congress in 2023, calling for scientific reporting frameworks.
Nimitz Tic Tac David Fravor Congressional Testimony
JS
active 2004
Lt. Commander, USN (Ret.); pilot/WSO
Observed the erratic movements and sudden hypersonic departure of the Tic Tac UAP alongside Dietrich during the 2004 USS Nimitz intercept training mission.
KD
b. ~1962
Senior Chief Operations Specialist, USN (Ret.)
Air Defense Controller aboard the USS Princeton. Tracked the Tic Tac targets on SPY-1 radar for days as they descended from 80,000 feet, and made the decision to vector Fravor to the intercept.
Nimitz Tic Tac Radar SPY-1
GV
active 2004
Fire Controlman, USN (Ret.)
Aboard the USS Princeton. Monitored the SPY-1 radar tracks and visually confirmed the objects through high-powered ship binoculars. Noted sonar reports of fast-moving underwater targets.
Nimitz Tic Tac Radar Visual Witness
PH
active 2004
Aviation Warfare Systems Operator, USN (Ret.)
Aboard the USS Nimitz. Witnessed the confiscation of the E-2C Hawkeye's radar data tapes by unidentified men immediately after the Tic Tac intercept.
Nimitz Tic Tac Confiscation E-2C Hawkeye
CU
active 2004
Fighter Pilot, USN (Ret.)
Successfully tracked the UAP using an ATFLIR pod, producing the famous "FLIR1" video. Coined the name "Tic Tac" to describe the object's physical shape. Reported active radar jamming from the target.
Nimitz Tic Tac FLIR1 Radar Jamming
CH
Lt. Colonel, USAF (Ret.); Deputy Base Commander
Led the Night Two investigation during the 1980 Rendlesham Forest incident. Recorded the "Halt Tape" in real-time and filed the official military memo on the event to the UK Ministry of Defence in January 1981.
Rendlesham Halt Tape Nuclear-UAP MoD Memo
JP
Sergeant, USAF (Ret.); Security Police Patrol Leader
Approached and touched the landed triangular craft during Night One of the 1980 Rendlesham Forest incident. Made detailed sketches of glyphs on the hull. Later claimed a binary mental download.
Rendlesham Glyphs Binary Code
JB
active 1980
Security Patrolman, USAF (Ret.)
Accompanied Penniston during the Night One Rendlesham encounter. Suffered radiation-related injuries and successfully won a VA medical settlement with the aid of Senator John McCain in 2015.
Rendlesham Radiation VA Settlement John McCain
LW
Security Patrolman, USAF (Ret.); author
Co-authored Left at East Gate. Claimed a controversial third-night encounter at Capel Green involving non-human entities, which remains widely disputed by other base witnesses.
Rendlesham Left at East Gate Capel Green Disputed
Fourth Air Force Intelligence officers, Hamilton Field, CA
Army Air Forces intelligence officers dispatched from Hamilton Field, California, to Tacoma to investigate the Maury Island incident in late July 1947. After interviewing Harold Dahl and Fred Crisman and collecting samples of the alleged "slag," both men concluded the affair was almost certainly a hoax. In the early hours of August 1, 1947, their B-25 Mitchell caught fire and crashed near Kelso, Washington, killing both officers — the first fatalities directly tied to a UFO investigation. The official cause was an in-flight engine fire; the coincidence of timing nonetheless fueled decades of cover-up speculation.
HN
active 1989
Gendarmerie Patrol Officer, Eupen
Belgian gendarmerie police officer who, along with patrol partner Hubert von Montigny, officially initiated the Belgian UFO Wave on November 29, 1989. While patrolling near Eupen, they observed a silent, triangular platform hovering over a field, projecting a light beam, and tracked it for over an hour.
Belgian Wave Gendarmerie
HM
Gendarmerie Patrol Officer, Eupen
Belgian gendarmerie police officer who, along with patrol partner Heinrich Nicoll, officially initiated the Belgian UFO Wave on November 29, 1989. While patrolling near Eupen, they observed a silent, triangular platform hovering over a field, projecting a light beam, and tracked it for over an hour.
Belgian Wave Gendarmerie
AC
active 1989
Gendarmerie Dispatcher, Eupen Headquarters
The gendarmerie dispatcher on duty on November 29, 1989. After receiving the radio reports from Nicoll and von Montigny, he stepped outside the Eupen station and visually confirmed the triangular craft. He coordinated the patrols and verified ground tracking with military radar.
Belgian Wave Gendarmerie
DP
active 1989
Gendarmerie Officer, Eupen Patrol
A gendarmerie officer dispatched by Creutz on November 29, 1989. Plumanns and his partner tracked the silent triangular craft as it moved slowly at low altitude toward the Gileppe Dam, providing crucial second-patrol corroboration.
Belgian Wave Gendarmerie
PJ
Major (later General), Iranian Air Force; pilot
Commanded the F-4 Phantom II jet scrambled to intercept a brilliant, flashing UAP over Tehran on September 19, 1976. Reported that when he attempted to fire a Sidewinder missile at the object, his weapons control panel and communications systems were jammed. Later testified at the National Press Club in 2007, corroborating the DIA's assessment of the case as an outstanding investigation.
Tehran 1976 Weapons Jamming F-4 Phantom
RH
Director of Central Intelligence (1947–1950)
The first Director of Central Intelligence (1947–1950), serving at the time of the Roswell incident. His name appears on the disputed MJ-12 documents as a member of the alleged committee managing recovered extraterrestrial technology — documents widely considered forgeries. More significantly, after retirement Hillenkoetter joined the board of NICAP (the civilian UFO research organization T. Townsend Brown founded in 1956) under director Donald Keyhoe, and publicly stated that UFOs were real and that the public was not being told the truth — a remarkable declaration from a former CIA Director.
roswellgovernmentintelligenceCIAMJ-12NICAP
VB
1890 – 1974
Director, Office of Scientific Research & Development
One of the most influential scientists in U.S. government history. As Director of the Office of Scientific Research and Development during WWII, Bush oversaw the Manhattan Project and coordinated all wartime scientific research. His name appears on the disputed MJ-12 documents as a member of the alleged secret Roswell committee — documents widely considered forgeries. His real-world role made him the most plausible candidate for leading a genuine scientific assessment of recovered technology.
roswellgovernmentscienceMJ-12WWII
Chief of Operations, Belgian Air Staff; Major General (ret.)
As Chief of Operations of the Belgian Air Staff, De Brouwer led the military's official investigation into the 1989–1990 Belgian UFO Wave — the most transparent government response to a mass UAP event in history. He coordinated the F-16 scramble on the night of March 30–31, 1990, formally queried the U.S. Embassy about classified stealth overflights (U.S. denied any), and oversaw the public release of cockpit radar recordings and telemetry data. De Brouwer consistently rejected mass hysteria explanations, stating publicly that the radar data and trained observer testimony indicated a genuine physical phenomenon beyond known technology. He later contributed a first-hand account to Leslie Kean's 2010 book UFOs: Generals, Pilots, and Government Officials Go on the Record.
belgian-wavegovernmentmilitaryF-16radarNATOBelgium
F-16 Pilot — March 30–31, 1990 Intercept
One of the Belgian Air Force F-16 pilots who flew the historic intercept mission on the night of March 30–31, 1990. Flying from Beauvechain Air Base, Meelbergs and his wingman achieved nine radar lock-ons on an anomalous target over the course of approximately two hours. In each lock, the target executed maneuvers — accelerating from 150 to 970 knots in under two seconds while simultaneously dropping thousands of feet — that broke the F-16's AN/APG-66 fire-control computer's tracking algorithm. The Belgian Air Force officially documented that the maneuvers were "completely abnormal" and could not be explained by any known aircraft or drone technology.
belgian-wavegovernmentmilitaryF-16pilotradarBelgium1990
Lieutenant Colonel, U.S. Army; DAIG Investigator
Assigned by the Department of the Army Inspector General (DAIG) in 1981 to investigate the Cash-Landrum incident. He conducted a thorough inquiry into allegations of military helicopters escorting a glowing UFO. Sarran concluded that the witnesses were credible and had indeed encountered an unidentified phenomenon, but found no flight logs or operational records of military helicopters in the area. His report remains a key official document validating the occurrence while denying military involvement.
DAIG Cash-Landrum Cash-Landrum Sighting
FG
1882 – 1963
Major General, IV Antiaircraft Command
Commanded the IV Antiaircraft Command, whose 37th Coast Artillery Brigade fired the anti-aircraft barrage over Los Angeles on February 24–25, 1942 — roughly 1,440 rounds at unidentified aerial targets during the hour-long blackout. A prior version of this site named this figure "Brigadier General William S. Fulton," a name and rank not found in any documented record of the incident; corrected to the actual, verifiable IV Antiaircraft Command commander.
Army Artillery Battle of LA
GM
1880 – 1959
General of the Army & Chief of Staff
As Chief of Staff of the U.S. Army, General Marshall authored a Top-Secret memo to President Roosevelt on February 26, 1942, stating that unidentified slow-flying aircraft were over Los Angeles during the blackout. Marshall contradicted Navy Secretary Knox's "false alarm" claim, verifying the incident's physical reality.
Army White House Battle of LA
FK
1874 – 1944
Secretary of the Navy
Serving as Secretary of the Navy during the outbreak of WWII, Knox famously held a press conference immediately following the Battle of Los Angeles, dismissing the entire engagement as a "false alarm" caused by "war nerves." His statements initiated a public dispute with the Army's internal assessment.
Navy White House Battle of LA
JT
Prime Minister of Canada
Authorized the joint U.S.-Canada NORAD mission on February 11, 2023, to shoot down an unidentified high-altitude object over the Yukon Territory, which was intercepted by a U.S. F-22 fighter jet.
Canada NORAD Yukon
JB
b. 1942
46th President of the United States
Ordered the shootdowns of three unidentified aerial objects over Alaska (Feb 10), Yukon (Feb 11), and Lake Huron (Feb 12) during the February 2023 airspace incursions, following the shootdown of a Chinese balloon on Feb 4.
President NORAD Yukon Lake Huron
GV
USAF General, Commander of NORAD & USNORTHCOM (2020–2024)
Led the military tracking and intercept operations during the February 2023 high-altitude objects incursions. Admitted that the military was unable to determine the propulsion or origin of the shot-down objects.
NORAD USAF Yukon Lake Huron
JK
b. 1963
NSC Coordinator for Strategic Communications
Served as the primary White House spokesperson briefing the public and media on the detection, tracking, and recovery efforts of the three unidentified objects shot down in February 2023.
White House Yukon Lake Huron
AB
U.S. Secretary of State
Coordinated diplomatic messaging with Canada and international partners during the February 2023 UAP shootdowns, contextually following the diplomatic fallout of the Chinese balloon incident.
State Dept Yukon
KJ
White House Press Secretary
Provided official daily press briefings on the administration's response to the February 2023 UAP shootdowns, confirming the establishment of an interagency team to study high-altitude objects.
White House Yukon Lake Huron
SK
Founding Director, All-domain Anomaly Resolution Office (2022–2023)
Laser and materials physicist who led AARO through its first year, which began with the February 2023 shootdown series. After leaving government service, he stated the three non-balloon objects downed that week were “almost certainly all balloons,” and explained that footage declassification was “prioritized based on the geopolitical environment.” On April 19, 2023, Kirkpatrick presented the office's first declassified drone-captured UAP video — a silvery, spherical object filmed by an MQ-9 Reaper near Deir ez-Zor, Syria — to the Senate Armed Services Subcommittee on Emerging Threats and Capabilities, telling lawmakers “this is, essentially, all the data we have associated with this event” and that “I will not close a case that we cannot defend the conclusions of.”
U.S. Senator (D-NY); Chair, Senate Armed Services Subcommittee on Emerging Threats and Capabilities
A longtime advocate for expanded UAP reporting protections and a secure whistleblower reporting channel, Gillibrand chaired the April 19, 2023 open subcommittee hearing on AARO's mission, activities, oversight, and budget — the session at which Dr. Sean Kirkpatrick first publicly showed the "Middle East Object" MQ-9 Reaper footage. She used the hearing to press AARO on its reporting chain to the Deputy Secretary of Defense and criticized what she called an "irresponsibly anemic and slow" federal response to a topic that would warrant urgent investigation if attributed to a foreign adversary.
JB
U.S. Representative, Michigan's 1st District; Lt. Gen. (Ret.), USMC
Retired Marine Corps lieutenant general and former naval aviator representing Michigan's Upper Peninsula. The first public official to describe the Lake Huron object's shape, confirming it was “octagonal” within hours of the February 12, 2023, shootdown.
Congress Lake Huron
TW
b. 1964
Governor of Minnesota; former Command Sergeant Major, Army National Guard
Governor of the state whose 148th Fighter Wing Air National Guard unit carried out the February 12, 2023, Lake Huron intercept. A 24-year Army National Guard veteran himself, he publicly praised the unit's performance after the shootdown.
Minnesota Lake Huron
ES
U.S. Senator, Michigan (formerly U.S. Representative, 2019–2025)
Former CIA Middle East analyst representing Michigan in Congress at the time of the Lake Huron shootdown. Publicly pressed for a full congressional briefing on the object and any recovered wreckage in the days after the engagement.
Congress Lake Huron
Technical Sergeant, USAF; Watch Supervisor, RAF Lakenheath RATCC (1956)
Senior USAF radar controller on duty at Lakenheath the night of August 13–14, 1956. His unsolicited February 1968 letter to the Condon Committee, written twelve years after the fact, supplied the first detailed narrative of the Venom night-fighter interception and became the primary evidentiary basis for the case's inclusion in the Condon Report.
RAF Lakenheath Condon Committee Lakenheath–Bentwaters
Pilot, First Venom NF.3, No. 23 Squadron RAF
Piloted the first Venom night-fighter scrambled toward the Lakenheath radar contact. Located and interviewed decades later by researchers David Clarke, Andy Roberts, Martin Shough and Jenny Randles, Chambers stated the sortie involved no tail-chase or evasive maneuvering and no visual contact, telling investigators bluntly: "my feeling is that there was nothing there, it was some sort of mistake."
Navigator, First Venom NF.3, No. 23 Squadron RAF
Navigator aboard the first Venom scrambled toward the Lakenheath contact on August 13–14, 1956. When located and interviewed decades later, Brady and pilot David Chambers confirmed they were scrambled roughly two hours later than the classic Perkins/Wimbledon timeline claims, and described an unremarkable sortie with no dramatic chase.
Pilot, Second Venom NF.3, No. 23 Squadron RAF
Piloted the second Venom vectored toward the Lakenheath contact. His account, obtained by researchers in the 2000s, described a scramble at roughly 02:40 GMT — far later than the classic narrative — and an unremarkable radar contact rather than the dramatic pursuit recounted by ground controllers Perkins and Wimbledon.
Navigator, Second Venom NF.3, No. 23 Squadron RAF
Navigator on the second Venom sortie of the night. His later recollection was deflationary: "all we saw was a blip which rather indicated a stationary target." No. 23 Squadron's own contemporaneous theory was that the contact had most likely been a weather balloon.
Commanding Officer, No. 23 Squadron RAF
Squadron commanding officer who, research by David Clarke later established, personally flew a Venom that same night after being diverted from RAF Coltishall to investigate the same radar returns. Because his flight window overlaps the interception described by Perkins and Wimbledon, some researchers suspect Davis — not the crews who were later tracked down — may have been one of the pilots the ground controllers actually recalled hearing on the radio.
No. 23 Squadron Lakenheath–Bentwaters
Crew, Earlier Venom Sortie, No. 23 Squadron RAF
Flew an earlier, unrelated Venom sortie on the night of the incident with Grahame Scofield, scrambled without being told the nature of the target and forced to abort after a wingtip fuel-tank malfunction. The path of this aborted flight is now considered the most plausible explanation for a separate 1978 civilian sighting report over Ely, Cambridgeshire.
Crew, Earlier Venom Sortie, No. 23 Squadron RAF
Flew the same aborted early-evening sortie as Leslie Arthur. Back at Waterbeach later that night, Scofield recalled monitoring radio traffic from the later interception — and, oddly, his recollection matched the dramatic Perkins/Wimbledon version far more closely than what the actual interception crews later said had happened, a discrepancy never fully resolved.
Crew, T-33 Trainer, 512th Fighter Interceptor Squadron, USAF
Dispatched with Andrew Rowe from Bentwaters to visually investigate the first radar contacts of the night; the two reported seeing nothing unusual apart from a single amber, star-like object almost certainly the planet Mars. Their negative sighting is an important data point showing not every radar anomaly that night had a visible counterpart.
Crew, T-33 Trainer, 512th Fighter Interceptor Squadron, USAF
Flew with Charles Metz on the T-33 sent up from Bentwaters to visually check the earliest radar returns; the crew reported nothing unusual beyond an amber light subsequently identified as almost certainly the planet Mars, low on the horizon.
Ground Controlled Interception (GCI) Controller, RAF Neatishead
Wrote to the Sunday Times in March 1978 disputing an article crediting skeptic Philip J. Klass with explaining the Lakenheath–Bentwaters case. Identified himself as the RAF controller who had actually vectored the two Venom night-fighters to the intercept from Neatishead, corroborating the core "chase" narrative from his own recollection of a solid, multi-radar-tracked target.
Deputy Director for Science and Technology, CIA
Oversaw the CIA's Project Palladium, a documented Cold War radar-deception ("spoofing") program that began in 1962. His tenure is cited in discussions of the Lakenheath–Bentwaters case as a real historical example of the kind of program sometimes speculatively invoked to explain 1950s British radar-visual incidents — though Palladium's own timeline began six years after that specific incident, and no documentary evidence ties it to the events of August 1956.
CIA Project Palladium Lakenheath–Bentwaters
Chief, Project Blue Book (April 1956 – October 1958)
Headed Project Blue Book when it closed the Levelland case as "Explained: Astronomical/Weather" (ball lightning) on November 15, 1957. Known even among colleagues for an aggressive determination to close cases with a conventional explanation wherever one could plausibly be constructed.
Project Blue Book Levelland
Field Investigator, 1006th Air Intelligence Service Squadron, USAF
Dispatched to Levelland three days after the sightings, Barth spent roughly seven hours in the field, interviewing only three of the approximately fifteen callers, and filed the report — emphasizing witness Pedro Saucedo's limited formal education — that fed into the Air Force's "ball lightning" conclusion.
1006th AISS Levelland
Texas State Representative, Odessa
Publicly wondered whether the Levelland object might be a secret American test vehicle and sent a telegram to Air Force headquarters in Washington demanding an explanation, helping propel the story to national attention on November 4, 1957.
Aircraft Commander / Pilot, RB-47H 53-4299, 55th Strategic Reconnaissance Wing
Pilot and aircraft commander of the RB-47H shadowed for over an hour on July 17, 1957. Chase was the primary visual witness and made the operational decision to contact ADC Radar Station Utah, producing the case's critical three-channel corroboration. He did not discuss the case publicly for a decade, finally volunteering his account to Condon Committee investigator Roy Craig in June 1967.
Copilot, RB-47H 53-4299, 55th Strategic Reconnaissance Wing
Independently corroborated pilot Lewis Chase's visual sightings at multiple points during the July 17, 1957 encounter, including the red lights near Duncanville that matched Frank McClure's simultaneous ELINT bearings — a second trained cockpit observer confirming events in real time.
Navigator, RB-47H 53-4299, 55th Strategic Reconnaissance Wing
Tracked the RB-47's position throughout the mission and its unplanned deviation to pursue the target, providing the navigational data that let investigators correlate the aircraft's position with Radar Station Utah's independent ground returns and reconstruct the case's roughly 600–700-mile ground track.
Electronic Warfare Officer, No. 1 Monitor (APD-4), RB-47H 53-4299
His independently operated APD-4 direction-finder corroborated Frank McClure's No. 2 monitor bearing over Texas — physically separate hardware on a different antenna system reporting the same unexplained emitter, ruling out a single-receiver malfunction.
Electronic Warfare Officer, No. 2 Monitor (ALA-6), RB-47H 53-4299
First crew member to detect an anomaly, registering an unusual signal near Gulfport that seemed to orbit the aircraft rather than behave like a fixed ground source. His log of signal bearings tracked in near-real-time correlation with the crew's visual sightings and Radar Station Utah's ground returns for over an hour.
Electronic Warfare Officer, No. 3 Monitor, RB-47H 53-4299
Manned the RB-47's lower-frequency No. 3 monitor, not directly implicated in the primary signal detections; his post-flight statement corroborated the crew's overall account of the mission profile and sequence of events reported to Wing Intelligence.
Wing Intelligence Officer, 55th Strategic Reconnaissance Wing
Prepared the four-page case summary of the RB-47 crew's encounter, transmitted up the Air Defense Command chain to Ent AFB, Colorado — part of the paper trail that would not reach Project Blue Book itself for over three months.
Commanding Officer, Operação Prato
A captain and intelligence officer in the Brazilian Air Force (FAB) who was appointed by General Protásio Lopes de Oliveira to lead the official reconnaissance mission Operação Prato in late 1977. Tasked with investigating the "chupa-chupa" light attacks on Colares Island, his team captured hundreds of photographs and hours of Super-8 film. Hollanda transitioned from skeptic to believer after observing low-altitude craft, including a 100-meter cylindrical mothership. In 1997, he granted a detailed interview disclosing these findings, criticized military secrecy, and was found dead by suicide under highly debated circumstances shortly after.
DB
Active since 2010
USAF Veteran & Geospatial Intelligence Specialist
Former USAF "1N1" geospatial analyst who testified before Congress on September 9, 2025. Borland reported a firsthand 2012 encounter with a silent, 100-foot equilateral triangular UAP at Langley Air Force Base. He has provided testimony to the ICIG and AARO detailing legacy UAP program activities and subsequent professional reprisals.
Langley AFB Incursions Whistleblower
JN
Active since 2003
USAF Security Forces Officer (Ret.)
A retired Air Force Security Forces officer who testified before Congress alongside Dylan Borland. He detailed a significant 2003 encounter at Vandenberg AFB, where multiple security patrols reported a red glowing disc hovering over the launch complexes, which disabled electronics.
Whistleblower Vandenberg AFB
AW
Active since 2025
US Navy Senior Chief Petty Officer
US Navy Senior Chief Petty Officer who testified at the September 2025 Congressional UAP hearings. He provided firsthand intelligence reports regarding UAP observations within Navy operational zones and corroborated military coordination around unexplained contacts. Earlier in his career he served as a radar/air-tracking specialist aboard the USS Omaha during its July 2019 deployment, one of roughly ten Navy vessels that reported unidentified contacts off Southern California that month; he has since described himself publicly as a witness rather than a whistleblower to that specific event, saying he remains "skeptical" of his own observations.
GG
Active since 2024
General, USAF & NORAD Commander
General serving as Commander of NORAD and USNORTHCOM. In March 2024, he testified before the Senate Armed Services Committee regarding the mystery drone swarm incursions over Joint Base Langley-Eustis and Langley AFB, acknowledging the operational difficulties in tracking and neutralizing them.
CM
Active 2010 – 2017
Former ICIG & Attorney for David Grusch
The first Senate-confirmed Intelligence Community Inspector General (ICIG) from 2010 to 2017. Later served as legal counsel for UAP whistleblower David Grusch, guiding him through the PPD-19 filing process to the current ICIG. McCullough also acts as a key policy advisor to the Sol Foundation.
David Grusch Sol Foundation
MT
Active since 2003
US Representative & HPSCI Chairman
US Representative from Ohio and Chairman of the House Permanent Select Committee on Intelligence (HPSCI). Turner has faced significant criticism from UAP disclosure advocates for allegedly blocking David Grusch's access to a SCIF for members of Congress and opposing UAP disclosure legislation.
HPSCI
SR
b. ~1950
Air Traffic Controller, Melbourne FSU
The Flight Service Officer on duty who communicated directly with Frederick Valentich during his final six minutes of flight, documenting his descriptions of the anomalous craft before radio contact was permanently lost.
Melbourne FSU Valentich Disappearance
CL
RAF Press Officer (Ret.)
The former Royal Air Force officer who investigated the Calvine incident in 1990 and broke official secrecy protocols by keeping a copy of the original photograph, releasing it in 2022.
RAF Calvine UFO Incident
NP
b. 1965
UAP Investigator, Ministry of Defence (1991–1994)
Worked at the UK MoD's UFO desk and saw the original Calvine photograph blown up as a poster on the wall. Has written and lectured extensively on the case, calling it the most compelling UAP photo ever. On the 1974 Berwyn Mountains Incident, reviewed the department's files and concluded plainly: "the real explanation is rather more prosaic … a combination of a small earthquake and a meteor shower, together with some subsequent hoaxing and exaggeration."
Captain, U.S. Air Force; Project Blue Book Investigating Officer
Captain Reichmuth conducted the U.S. Air Force's official investigation of Rex Heflin's 1965 UFO photographs on behalf of Project Blue Book, interviewing Heflin for more than three hours in September 1965 and independently checking his character and employment record with the Orange County Road Department. His own report concluded, "From all appearances, he is not attempting to perpetrate a hoax" — a finding Blue Book's own final case disposition, based on a separate photo-recreation experiment, would controversially override.
RH
b. c. 1936
Former Chief Scientist for Systems, GEC-Marconi; Widely Reported Author, Project Condign
A former RAF serviceman from age 18 in 1954, radar/guided-weapons specialist at RAF Cranwell from 1977, and holder of a 1982 PhD on radar target detection in clutter, Haddow rose to Chief Scientist for Systems at GEC-Marconi while separately consulting for a Ministry of Defence department. He is the individual most widely, though never officially, identified as the sole author of Project Condign, the MoD's classified 1996–2000 study attributing most unexplained UK UAP reports to "buoyant plasma formations." An internal 1998 memo attributed to him shows he anticipated the study's central recommendation — that DI55 cease UAP monitoring — more than two years before the report's completion. He has never confirmed authorship on the record and has told researchers he wishes to maintain a low profile.
GEC-Marconi DI55 / Defence Intelligence Staff Project Condign Summary
YG
1934 – 1968
Soviet Cosmonaut & First Human in Space
Soviet pilot who completed the first human spaceflight on April 12, 1961, just six days before the Eagle River Pancake Incident occurred, marking a critical geopolitical context.
Vostok 1 Eagle River Pancake Incident
RF
Director, Project Blue Book (1958–1963)
USAF Lieutenant Colonel and decorated Tuskegee Airman who led Project Blue Book and personally investigated the Eagle River pancake case, ordering chemical analyses of the food items.
Project Blue Book Eagle River Pancake Incident
LN
F-84 Thunderjet Pilot, 54th Fighter-Interceptor Squadron, Ellsworth AFB
A World War II and Korean War combat veteran who flew the second F-84 interceptor scrambled against the Ellsworth AFB target on August 5, 1953, pursuing it through white-to-green color changes to roughly 26,000 feet. He deliberately tested for cockpit reflections and checked the object's motion against fixed stars before his radar-ranging gunsight achieved a lock, and admitted genuine fear despite his combat record before breaking off the chase.
MF
Active 1953
Air Technical Intelligence Center (ATIC), Wright-Patterson AFB
An ATIC colleague of Edward Ruppelt's who, despite a year of reading UFO reports without ever finding one convincing, telephoned Ruppelt before dawn on August 11, 1953 to insist he personally read the wire on the Ellsworth AFB sighting — the call that sent Ruppelt to Rapid City to investigate firsthand.
JS
USAF Director of Intelligence
Presided over the largest Pentagon press conference since World War II on July 29, 1952, called to address the Washington National Airport radar-visual sightings. Samford told reporters the reports were taken seriously because of "the character of the observers" but publicly attributed the radar returns to temperature inversion — an explanation several of the controllers who worked the case never accepted.
HB
Active 1952
Senior Air Traffic Controller, Washington National Airport
Senior CAA controller who confirmed the unidentified radar returns his subordinate, Edward Nugent, was tracking on the night of July 19–20, 1952, had two colleagues verify the equipment was functioning normally, and alerted Andrews Air Force Base once the targets crossed over the White House and Capitol. He also orchestrated a fourteen-minute real-time radar-to-visual correlation with Capital Airlines Capt. Casey Pierman, and later wrote that the objects' movements were "completely radical compared to those of ordinary aircraft."
National Airport Radar Center Casey Pierman Washington D.C. UFO Flap
EN
Active 1952
Air Traffic Controller, Washington National Airport
The controller who first spotted seven unidentified blips on radar 15 miles south-southwest of the city at 11:40 p.m. on July 19, 1952, positioned where no known aircraft or flight path existed — the detection that set the entire Washington flap in motion.
Control Tower Radar Operators, Washington National Airport
Controllers in the airport's separate radar-equipped control tower who independently confirmed the same unidentified blips Harry Barnes and Edward Nugent were tracking on the main radar center's scope, and watched a bright light hover before departing "with incredible speed." In a 2002 interview, Cocklin maintained he "saw it on the screen and out the window."
DF
Project Blue Book Pentagon Liaison Officer
Air Force major serving as Project Blue Book's liaison at the Pentagon who traveled to National Airport's radar room during the July 26–27, 1952 sightings. Fournet stated that everyone present that night believed the targets were "solid metallic objects" — a judgment at odds with the Air Force's public temperature-inversion explanation two days later. Five days earlier, he had reportedly characterized the July 14 Nash-Fortenberry sighting as one of the most detailed and reliable reports the Air Force had received. In January 1953 he presented a "motions study" of the strongest multi-witness and radar-visual cases to the CIA-convened Robertson Panel, including the July 24, 1952 Carson Sink Incident as "Case 11," arguing the objects' coordinated maneuvers showed evidence of intelligent control.
JH
Active 1952
U.S. Navy Radar Specialist
Navy radar officer brought to National Airport's radar center on the flap's second weekend. After the Washington National Weather Station reported a slight temperature inversion, Holcomb determined it was "not nearly strong enough" to account for the strong, solid returns the controllers were watching.
AC
1921 – 1999
Press Spokesman, Project Blue Book / Pentagon
Civilian press officer who represented Project Blue Book to reporters during the flap and declined journalists' requests to photograph the radar scopes on security grounds. He later recounted interceptor pilot Lt. William Patterson's alarmed radio transmission — "I see them now and they're all around me. What should I do?" — for which ground control had no answer.
F-94 Starfire Interceptor Pilots, New Castle AFB
Air Force jet pilots scrambled toward Washington on the night of July 26–27, 1952. Flight leader Capt. McHugo was repeatedly vectored toward radar targets but saw nothing; his wingman, Lt. Patterson, chased four glowing white lights at his aircraft's top speed and could not close the distance before ground control lost radio contact with him mid-pursuit.
Ground personnel at Andrews Air Force Base who independently reported glowing, maneuvering lights on both weekends of the flap. Airman Brady described "an orange ball of fire trailing a tail" that departed at "unbelievable speed"; Staff Sgt. Davenport and Master Sgt. Cummings each reported lights that hovered, then abruptly changed direction and altitude, unlike any meteor or aircraft they had seen.
HR
Physicist; Chair, CIA Robertson Panel
Caltech physicist who chaired the CIA-convened panel of scientists that reviewed Project Blue Book's strongest cases — including Washington and Nick Mariana's Great Falls, Montana film — over four days in January 1953. The panel found no evidence of a national-security threat but recommended the Air Force strip UFOs of "the special status they have been given," a recommendation that shaped two decades of official public debunking. It reclassified the Mariana film as showing "reflections of aircraft known to have been in the area."
FD
Rocketry Engineer; CIA Space Analyst; Robertson Panel Secretary
A Navy test pilot turned rocketry engineer (Bell Aircraft, then director of engineering at the Naval Air Rocket Test Station) who became a CIA space and missile analyst and, in 1953, president of the American Rocket Society. As the Robertson Panel's secretary, Durant authored the 38-page internal memorandum — the "Durant Report" — that remains the fullest surviving account of the panel's closed-door sessions and the individual members' off-the-record comments. He later spent 15 years as Assistant Director for Astronautics at the Smithsonian's National Air and Space Museum.
MC
Dates not established in public record
Assistant Director, CIA Office of Scientific Intelligence
The CIA's Assistant Director for Scientific Intelligence, who briefed Director of Central Intelligence Walter Bedell Smith in late 1952 that "something was going on that must have immediate attention" regarding UFO reports, prompting the Intelligence Advisory Committee's December 4, 1952 decision to enlist outside scientists. Chadwell personally helped assemble the Robertson Panel the following January, opened its first session with a review of CIA's prior interest in the subject, and rejoined its later meetings alongside Brig. Gen. William Garland.
HT
1884 – 1972
33rd President of the United States
President during the July 1952 flap. His Air Force aide telephoned Edward Ruppelt for an explanation of the Washington sightings, with Truman listening in as Ruppelt — without having yet formally investigated the case — relayed the temperature-inversion theory he had just heard from radar specialist Roy James.
RJ
Active 1952
USAF Radar Specialist
Radar specialist consulted by Edward Ruppelt immediately after the flap's first weekend. James's off-the-cuff suggestion that "unusual weather conditions" could produce false radar targets became the basis of the explanation Ruppelt gave President Truman's office and, ultimately, of the Air Force's official public position at the July 29 press conference.
GH
Active 1997
CIA Chief Historian
CIA in-house historian whose 1997 study, published in the Agency's own journal, documented that "the massive buildup of sightings over the United States in 1952, especially in July," genuinely alarmed the Truman administration and drove the CIA's classified review of the UFO problem that led to the Robertson Panel.
WS
Director of Central Intelligence (1950–1953)
CIA Director who received the September 1952 Office of Scientific Intelligence memorandum warning that the "flying saucer situation" carried national-security implications through its potential to touch off "mass hysteria and panic" — the memo that led directly to the formation of the Robertson Panel.
Robertson Panel Washington D.C. UFO Flap
TM
Flight Leader, 165th Fighter Squadron, Kentucky Air National Guard
Decorated WWII C-47 pilot who towed gliders into Normandy on D-Day. On January 7, 1948, led a pursuit of an unidentified object over Godman Field, Kentucky, continuing to climb past 25,000 feet without oxygen after his wingmen turned back. His F-51D Mustang crashed near his hometown of Franklin, Kentucky, making him the first American military pilot known to die while chasing a UFO.
Wingman, 165th Fighter Squadron, Kentucky Air National Guard
Flew with Capt. Thomas Mantell during the January 7, 1948 pursuit, breaking off around 22,000–22,500 feet due to lack of oxygen equipment. Described the object more cautiously than Mantell, calling it "a bright-appearing object, very small," and speculated it could be sunlight reflecting off another aircraft's canopy.
Wingman, 165th Fighter Squadron, Kentucky Air National Guard
The second wingman on the January 7, 1948 climb, Hammond experienced hypoxia symptoms including blurred vision and broke off the pursuit alongside Lt. Clements, descending safely — a decision that stands in stark contrast to Mantell's choice to continue climbing alone.
Pilot, 165th Fighter Squadron, Kentucky Air National Guard
The fourth pilot in Mantell's flight of F-51s on January 7, 1948, Hendricks continued on the original ferry route toward Standiford Field in Louisville rather than joining the climb toward the object — a minor but genuine inconsistency in how the flight's composition during the chase has been reported.
AL
1906 – 1963
Civilian Engineer & Field Investigator, Project Sign
A Wright Field aeronautical engineer specializing in low-aspect and flying-wing aircraft design, Loedding became one of Project Sign's most active field investigators, personally interviewing Capts. Clarence Chiles and John Whitted in Atlanta on July 26, 1948. Among the strongest advocates within Sign for taking the extraterrestrial hypothesis seriously, he was a substantial contributor to the classified "Estimate of the Situation" and was reportedly professionally sidelined within Air Force intelligence circles after Gen. Hoyt Vandenberg rejected the document.
JB
Captain, U.S. Air Force; Investigating Officer, Great Falls AFB
Interviewed Nick Mariana in October 1950 and arranged for his 16mm film to be forwarded to Wright-Patterson Air Force Base for analysis. Brynildsen's own account of how much footage he collected shifted between his statements to reporters ("about eight feet of film") and his official transmittal message ("approximately fifteen feet") — a small but persistent discrepancy that later researchers cite as an early sign of how loosely the film's chain of custody was documented.
RT
Active 1950
Lieutenant Colonel, U.S. Air Force, Wright-Patterson AFB
Returned Nick Mariana's film in late 1950 with a cover letter stating Air Force photo analysts "were unable to find anything identifiable of an unusual nature" in it. It was this same returned reel that Mariana would soon say was missing roughly thirty of its original frames — the ones he insisted showed the objects largest, closest, and most clearly rotating.
HV
1899 – 1954
Chief of Staff, U.S. Air Force (1948–1953); second Director of Central Intelligence (1946–1947)
As Air Force Chief of Staff, Vandenberg personally rejected Project Sign's classified "Estimate of the Situation" in October 1948, judging its evidence — drawn substantially from the Chiles-Whitted and Mantell cases — insufficient to support its extraterrestrial conclusion. Per Edward J. Ruppelt's later account, the rejected document was eventually declassified and destroyed. Vandenberg's decision set the cautious, conventional-explanation-first posture that defined official Air Force UFO policy through Project Grudge and into the Blue Book era.
KB
Lieutenant, Royal Swedish Air Force; field commander, Lake Kölmjärv search operation
Led the Swedish military's three-week underwater search of Lake Kölmjärv following the July 19, 1946 "ghost rocket" impact reported by Knut Lindbäck and Beda Persson. His official report concluded the object had likely "disintegrated itself," probably built of a lightweight magnesium alloy. Interviewed in 1984 by researcher Clas Svahn, an older Bartoll stood by the underlying observation, insisting "what people saw were real, physical objects" even as the object's nature remained unresolved.
GI
Active 1946
Lieutenant, Royal Swedish Air Force; B18A pilot
Piloting a twin-engine SAAB B18A over Dalarna on the morning of August 14, 1946, Irholm and his navigator spotted a finless, exhaust-free cigar-shaped object and gave chase, only for it to outrun their aircraft's top speed before disappearing into a rainstorm within about two minutes — one of the ghost rocket wave's few pursuit encounters by a trained military aircrew rather than a ground-based civilian witness.
JD
1896 – 1993
Lieutenant General, U.S. Army Air Forces (ret.); Medal of Honor recipient; Shell Oil Company executive
The famed WWII aviator and leader of the 1942 Tokyo raid traveled to Stockholm in August 1946, officially on private Shell Oil business but with access to Swedish military radar-tracking briefings on the ghost rockets alongside David Sarnoff. His presence, reported by the American press at the time, fed contemporary suspicion that the US government was quietly assessing the phenomenon through unofficial channels.
BJ
Active 1946
Colonel, Royal Swedish Air Force; chairman, Ghost Rocket Committee
Chaired the Swedish Defence Staff's "Ghost Rocket Committee," convened July 6, 1946, which held twelve documented meetings through December of that year weighing radar plots, debris analysis, and witness testimony. The committee's draft findings leaned toward "foreign experimental activity with reaction or rocket weapons" over Swedish territory before the final, publicly released version softened that conclusion considerably.
LC
1936 – 2013
Captain (later Lt. Col.), U.S. Army Reserve, 316th Medical Detachment (Helicopter Ambulance); civilian police officer
Pilot-in-command of the UH-1H Huey helicopter that nearly collided with an unidentified cigar-shaped object near Mansfield, Ohio on October 18, 1973. A 19-year aviation veteran, Coyne took the controls during the near-collision, executed the evasive descent, and personally observed the aircraft's altimeter recording a 1,000-foot-per-minute climb while the collective pitch control remained fully bottomed. He filed the crew's official report, cooperated extensively with CUFOS investigator Jennie Zeidman, and on November 28, 1978 personally testified before the United Nations General Assembly's Special Political Committee, telling delegates "I am convinced this object was real."
AJ
First Lieutenant, U.S. Army Reserve, 316th Medical Detachment (Helicopter Ambulance); chemical engineer
Copilot of the Army Reserve UH-1H Huey involved in the October 18, 1973 near-collision near Mansfield, Ohio. Seated at the flight controls throughout the encounter, Jezzi independently observed the same anomalous altimeter climb reading as Capt. Lawrence Coyne. In later interviews he offered a somewhat more measured characterization of the climb's severity than Coyne's account, a nuance later cited on both sides of the case's instrument-anomaly debate.
RY
Sergeant, U.S. Army Reserve, 316th Medical Detachment (Helicopter Ambulance); computer technician
Crew chief aboard the Army Reserve UH-1H Huey during the October 18, 1973 encounter near Mansfield, Ohio. The first crew member to spot the approaching red light on the southeast horizon near Charles Mill Lake, his initial alert to the cockpit began the chain of events leading to Capt. Coyne's evasive maneuver. At 23 the youngest crew member, his account of the object's approach, hover, and departure closely matched the other three crewmen's independent statements.
JH
Sergeant, U.S. Army Reserve, 316th Medical Detachment (Helicopter Ambulance); Cleveland Police Department detective
Flight medic aboard the Army Reserve UH-1H Huey during the October 18, 1973 near-collision near Mansfield, Ohio. Healey reported an earlier, separate red-light sighting to the west shortly before Sgt. Yanacsek's more urgent report of the converging object, and was among the crew bathed in green light that swept through the cabin. He remained willing to discuss the case publicly decades later, including at a 2011 library program in Ohio.
JG
1921 – 2013
62nd Governor of Ohio (1971–1975)
While driving with his wife during the same October 1973 "Ohio wave" that produced the Coyne helicopter incident, Gilligan reported a roughly thirty-minute sighting of an amber-colored, vertically oriented object that appeared to pace their car — a notable account given his status as a sitting governor with every institutional incentive to avoid the ridicule such reports often invited.
EG
1922 – 1997
First Prime Minister of Grenada (1974–1979)
A longtime advocate for United Nations investigation of UFO phenomena, Gairy sponsored the November 28, 1978 hearing of the UN General Assembly's Special Political Committee at which Lt. Col. Lawrence Coyne testified about his 1973 helicopter encounter alongside expert witnesses J. Allen Hynek and Jacques Vallée.
FM
1926 – 1953 (missing)
Pilot, F-89C Scorpion, Detachment 1, 433rd Fighter-Interceptor Squadron
A Korea-era pilot with more than 1,000 flight hours, born in Mansura, Louisiana, and assigned to the 433rd FIS at Truax Field, Wisconsin. On temporary duty at Kinross AFB the night of November 23, 1953, Moncla was scrambled to intercept an unidentified radar target over Lake Superior; his aircraft's radar return merged with the target's on ground scopes and both vanished. Neither he, his radar officer, nor the F-89C was ever found.
RW
1931 – 1953 (missing)
Radar Intercept Officer, F-89C Scorpion
A 22-year-old radar officer from Ponca City, Oklahoma, Wilson occupied the F-89C's rear seat on November 23, 1953, responsible for operating the aircraft's onboard radar and guiding Felix Moncla onto an unidentified target over Lake Superior. He disappeared alongside Moncla when their aircraft's radar return merged with the target's and vanished from every scope; neither man was ever found.
Ground Control Intercept Controller, Calumet Air Force Station ("PILLOW")
The GCI controller who handled the final vectoring of Felix Moncla's November 23, 1953 intercept over Lake Superior, reporting the target at the F-89's eleven o'clock position roughly ten miles out shortly before radio contact was lost. Stuart and his fellow controllers subsequently watched the fighter's and the target's radar returns converge into a single blip and vanish together.
GF
20th century
Royal Canadian Air Force Pilot, C-47 Dakota VC-912
The RCAF pilot the U.S. Air Force publicly identified as flying the "unknown" target intercepted by Felix Moncla on November 23, 1953. Located and interviewed by researcher Gordon Heath in 2004, Fosberg firmly denied ever being thirty miles off his Winnipeg-to-Sudbury flight plan and said he never saw the intercepting Scorpion and did not know he was being intercepted — testimony directly at odds with the official U.S. explanation of the Kinross Incident.
Royal Canadian Air Force Spokesman
RCAF spokesman who publicly denied, in both 1961 and 1963, that any Canadian aircraft had been involved in the November 23, 1953 Kinross Incident, specifically questioning whether the U.S. Air Force's claimed intercept scenario was even operationally plausible.
Former Division Chief, FAA Accidents & Investigations Branch
Former chief of the FAA's Accidents and Investigations Division, who led the agency's internal review of the November 17, 1986 Japan Air Lines Flight 1628 encounter over Alaska, in which the crew and, according to Callahan, FAA radar itself tracked an unidentified object pacing the aircraft for over thirty minutes. Callahan has repeatedly cited that episode in later interviews as evidence the FAA is institutionally capable of a far more serious response than the one it gave the November 2006 O'Hare International Airport sighting.
FAA Spokesman
Federal Aviation Administration spokesman who publicly elaborated the agency's "hole-punch cloud" explanation for the November 2006 O'Hare International Airport sighting in early 2007, describing the phenomenon as appearing "in a perfect circular shape like a round disc," while acknowledging that "the absence of any kind of factual evidence precludes an investigation."
FAA Midwest Public Affairs Manager
FAA Midwest region public affairs manager who delivered the agency's first public response to the November 2006 O'Hare International Airport sighting in January 2007, telling the Associated Press the FAA's "theory" was a weather phenomenon caused by a low cloud ceiling reflecting airport lights, and that a preliminary check of radar had "found nothing out of the ordinary."
Manager, FAA Alaskan Region Security Division
Personally interviewed the crew of Japan Air Lines Cargo Flight 1628 at Anchorage International Airport within hours of their November 17, 1986 encounter, alongside FAA security investigator Ron Mickle and FSDO investigator Jack Wright. Concluded the three crewmen were "normal, professional, rational" with no drug or alcohol involvement, later stating in interviews that they "didn't make this up. Something happened that scared them," and describing them as "very, very believable."
FAA Alaskan Region Spokesman
FAA spokesman who publicly retracted the agency's earlier radar-confirmation framing of Japan Air Lines Cargo Flight 1628 at a March 5, 1987 Anchorage press conference, characterizing the tracked return as an "uncorrelated primary target" — an unexplained split radar image of the aircraft's own signal — while stating the agency was "accepting the descriptions of the crew, but are unable to support what they saw."
Air Traffic Controller, Anchorage ARTCC
One of the Anchorage Air Route Traffic Control Center controllers who tracked an intermittent secondary radar contact pacing Japan Air Lines Cargo Flight 1628 on November 17, 1986. Remained on record after the FAA's later public retraction, maintaining that "all three of us thought there was a track."
43rd President of the United States (2001–2009)
President Bush owned Prairie Chapel Ranch near Crawford, Texas, which he used as a working ranch and occasional "Western White House" throughout his presidency. He is mentioned in the January 2008 Stephenville Lights case only because MUFON investigators reported an unidentified radar track that evening moving for over an hour on a course toward the ranch; no source confirms he was in residence at the time, and he has no other documented connection to the case.
Public Affairs Spokesman, 301st Fighter Wing
Spokesman for the Air Force Reserve's 301st Fighter Wing at Naval Air Station Joint Reserve Base Fort Worth who, on January 23, 2008, publicly confirmed that ten F-16s of the 457th Fighter Squadron had flown a night training mission over Erath County on January 8 — reversing the wing's earlier categorical denial that any of its aircraft were airborne that night, which he attributed to "an internal communications error."
Stephenville Lights Sighting 301st Fighter Wing 457th Fighter Squadron
USAF Wing Intelligence Officer
Led the four-officer team from the 7th District Office of Special Investigations that interviewed William B. Nash and William H. Fortenberry separately, then jointly, at 7:00 AM the morning after their July 14, 1952 sighting. Sharpe's own written characterization of the objects' sharpest maneuver as occurring at "a speed fantastic to contemplate" became one of the case's most quoted lines.
Director of Legislative Liaison, U.S. Air Force (1959)
Wrote to Senator Harry Flood Byrd on May 6, 1959, formally reaffirming the Air Force's public explanation that Capt. Peter W. Killian's February 24, 1959 sighting was an aerial refueling mission involving a KC-97 tanker and three B-47 bombers — an explanation later challenged on geometric grounds by NICAP and, in 1992, by Dr. Willy Smith's quantitative reanalysis.
Public Information Division, U.S. Air Force (1959)
Authored the Air Force's written correspondence defending the KC-97/B-47 refueling explanation for the Killian sighting in letters dated March 19 and June 24, 1959, specifying the tanker's roughly 17,000-foot operating altitude and 230-knot airspeed. Later authored the 1960 book Flying Saucers and the U.S. Air Force.
GC
Senior Warrant Officer (Maresciallo), Pilot, Italian Air Force
A career reconnaissance pilot with the 14° Gruppo, 2° Stormo, Cecconi was returning from a photo-reconnaissance mission over the Ligurian Apennines on June 18, 1979 when Istrana Air Base's radar directed him to an unidentified object near Treviso. He closed to within 70–80 meters over seven or eight passes, exposing more than eighty photographic frames on his aircraft's tactical reconnaissance cameras. Described by every investigator who interviewed him — in 1979 and again in 1994 — as an unusually credible, reluctant, and professionally respected witness whose account never materially changed.
RM
1921 – 1992
Prime Minister of New Zealand (1975–1984)
Took a documented personal interest in the December 1978 Kaikōura sightings as media coverage intensified in early January 1979, directing the RNZAF to formally investigate and specifically asking to be shown the resulting report's conclusions — a level of head-of-government engagement his own officials noted as unusual for a matter the Air Force had traditionally kept low-profile. His interest, combined with what officials privately called increasingly "negative" press coverage, helped push Wing Commander J. B. Clements' official report into a formal, published document.
Minister of Aeronautics, Brazil (1985–1990)
Convened and led the May 23, 1986 press conference at the Ministry of Aeronautics in Brasília, confirming radar detection of at least 20 unidentified objects the night of May 19–20 and telling reporters on the record, "technically, I'd tell you gentlemen that we have no explanation." Gave further detailed interviews in 1997 reaffirming his position and describing having personally briefed President José Sarney the night of the incident.
Chief, Air Defense Operations Center (CODA), Brazilian Air Force
Spoke alongside Minister Moreira Lima at the May 23, 1986 press conference, addressing the case's central technical puzzle head-on: recurring mismatches between radar returns and pilots' visual sightings. Stated the Air Force lacked the "technical operational conditions" to explain the objects' appearance and disappearance on radar screens.
Brazilian Air Force; later Minister of Aeronautics (1990–1992)
Present at the May 23, 1986 press conference, where he stated that similar, less-publicized radar cases had occurred previously, that FAB personnel had captured cine film of portions of the event, and that objects had accelerated from roughly 250 to 1,500 km/h within fractions of a second. As Minister years later, gave a further interview describing unusual radar sightings as a "regular occurrence" within the Air Force.
F-5E Pilot (FAB 4848), Santa Cruz Air Force Base
First fighter airborne on the night of May 19, 1986, launching at 22:34. Achieved sustained visual contact with a color-changing "ball of light" roughly 12 miles ahead while climbing past Mach 0.95, pursuing it out over the Atlantic before losing contact. Later described the object's behavior as involving "speeds and maneuvers impossible for any conventional aircraft."
F-5E Pilot (FAB 4849), Santa Cruz Air Force Base
Launched roughly twenty minutes after Marinho and reported the night's most striking radar event: thirteen simultaneous targets briefly surrounding his aircraft, six to one side and seven to the other, before vanishing. Also reported anomalous "diagonal streak" interference on his radar scope during the encounter.
Mirage III (F-103E) Pilot, Anápolis Air Force Base
First Mirage airborne from Anápolis on the night of May 19, 1986. Reported a target that consistently maintained a position behind his own aircraft despite his maneuvering, remarking to controllers that if it were a genuine object it had to be dark-colored, since he was "practically visual with the ground" at the time.
Mirage III (F-103E) Pilot (FAB 4913), Anápolis Air Force Base
Achieved the closest approach of any pilot on the night of May 19, 1986, closing to roughly one nautical mile of a radar/visual target while flying supersonic. In a 1993 TV Globo interview, nearly seven years after the event, estimated the object's peak departure speed at approximately Mach 15 — a striking but strictly retrospective, non-instrumented figure.
Mirage III (F-103E) Pilot, Anápolis Air Force Base
Flew the night's third Mirage sortie on May 19–20, 1986, making three separate intercept attempts over a 54-minute flight and closing to within one nautical mile at closest approach, without ever achieving simultaneous radar and visual confirmation of the same target.
Founder, Embraer; Incoming President, Petrobrás (1986)
Observed intense orange-red luminous objects from an executive Xingu aircraft on the night of May 19, 1986 while returning from a meeting with President Sarney, the evening before formally taking office as Petrobrás president. A reserve Air Force officer and aeronautical engineer by training, and the founder of Brazil's national aircraft manufacturer Embraer, Silva's account carries unusual technical and institutional weight among the case's civilian witnesses.
Air Traffic Controller, São José dos Campos Airport Tower
The night's first reporting witness, tracking color-changing lights from roughly 18:30 onward on May 19, 1986 and radioing Brasília with the line — "Brasília? Boa noite! Bem-vindo ao festival dos discos voadores" — that gave the incident its enduring popular nickname. Later stated publicly that the true number of objects observed that night exceeded the commonly cited figure of 21.
Interim Commander, Air Defense Command (COMDA)
Signed the formal June 2, 1986 FAB occurrence report on the incident, declassified in 2009, which concluded the phenomena were "solid" and "reflect intelligence" through their apparent capacity to track and maintain distance from observers and fly in formation — while explicitly noting this did not necessarily mean the objects were piloted. Also rebutted the leading space-debris explanation on technical grounds.
JS
President of Brazil (1985–1990)
Brazil's first civilian president after 21 years of military rule; per Minister Octávio Júlio Moreira Lima's later account, was personally briefed on the unfolding radar and pilot intercepts the same night, May 19–20, 1986. Colonel Ozires Silva, one of the case's civilian witnesses, was returning from a meeting with Sarney in Brasília at the time of his own sighting.
FC
Active 1979 – present
Mirage F1 Interceptor Pilot, Ala 14, Spanish Air Force
Launched from Los Llanos Air Base on the night of November 11–12, 1979 on an alert-interception mission and pursued unidentified lights near Valencia for roughly ninety minutes at speeds near Mach 1.4. Reported a color-shifting, truncated-cone object and simultaneous activation of his Mirage F1's radar-warning receiver and infrared missile-seeker threat systems with no corresponding sensor return — the Manises UFO Emergency Landing case's single most technically detailed instrumented account. Has maintained a materially consistent account across more than four decades of interviews and has explicitly and repeatedly rejected proposed conventional explanations.
EM
Socialist Deputy, Congress of Deputies, Spain
In September–October 1980, formally interpellated Spain's Ministry of Defense in the Congress of Deputies over the Manises UFO Emergency Landing, asking what had caused TAE flight JK-297's diversion, why unidentified traffic had lingered in Spanish airspace, and why a Mirage F1 had been scrambled. The published response — that there was no proof of a physical object, only of "lights" — became part of the case's official record and marked the first time the UFO phenomenon was formally raised on the floor of Spain's post-Franco democratic parliament.
Sukhoi Su-22 Pilot, Peruvian Air Force (FAP)
A 23-year-old FAP lieutenant on April 11, 1980, scrambled in his Sukhoi Su-22 to intercept an unidentified, light-bulb-shaped object hovering over La Joya Air Base, Peru. He fired 64 rounds of 30mm cannon fire across four passes with no visible effect on the object before it climbed beyond his aircraft's rated ceiling, the La Joya Air Base Incident. He has given a materially consistent account for more than three decades, including at the 2007 National Press Club press conference and the 2013 Citizen Hearing on Disclosure, and retired from the FAP as a full Colonel.
Base Commander, La Joya Air Base, Peruvian Air Force
Identified in secondary accounts as the commanding officer at La Joya Air Base who, on the morning of April 11, 1980, ordered Lt. Óscar Santa María Huertas to scramble and intercept an unidentified object hovering over restricted airspace, citing concern over possible espionage — the decision that opened the La Joya Air Base Incident. He is not known to have given extended public testimony under his own name.
Retired Officer, Peruvian Air Force (FAP)
A retired FAP officer who, decades after the fact, publicly explained the military's rationale for suppressing news of the La Joya Air Base Incident: acknowledging a UFO encounter, he said, would have drawn unwanted press and researcher attention to a base whose security posture the FAP preferred to keep unpublicized. His remarks are among the only on-record institutional commentary explaining why the case was not formally investigated or disclosed at the time.
OW
Commanding General, Far East Air Forces (1951–1954)
Took command of Far East Air Forces and UN Air Forces in June 1951 and led FEAF through the Korean War's tactical air campaigns, earning four-star rank in July 1952. Gave the Wonsan-Sunchon UFO Incident its most candid public assessment on March 6, 1952, telling reporters "we can't say there's nothing to it" while specifically undercutting his own service's tentative jet-exhaust theory, noting a viewer would need to be looking almost directly up a tailpipe to see its glow.
NT
Vice Chief of Staff, U.S. Air Force (1950–1953)
As the Air Force's second-highest uniformed officer, sent a March 5, 1952 memorandum to Secretary of the Air Force Thomas K. Finletter on the Wonsan-Sunchon UFO Incident, offering two explicitly "tentative" evaluations — Soviet fighter exhaust or an airborne searchlight — without ever confirming either. Would become USAF Chief of Staff in mid-1953 and later Chairman of the Joint Chiefs of Staff.
Chairman, Senate Armed Services Committee (1951–1953)
Powerful Georgia Democrat who, on February 21, 1952, formally requested a full Air Force accounting of the Wonsan-Sunchon UFO Incident after details leaked to the press — a rare instance of direct Congressional oversight into a Korean War-era UFO report, escalating a classified field investigation into a matter the Secretary of the Air Force had to personally answer for.
TF
United States Secretary of the Air Force (1950–1953)
Received Gen. Nathan F. Twining's March 5, 1952 memorandum on the Wonsan-Sunchon UFO Incident and was the cabinet-level official Sen. Richard B. Russell Jr. held responsible for producing a full Congressional accounting of the sightings.
RO
Active 1975
Major, Commanding Officer, CFS Falconbridge (1975)
Watched two brilliant objects through binoculars from the base on the morning of November 11, 1975, describing one as "rising vertically at tremendous speed," and phoned his report directly into the 22nd NORAD Region chain of command. Took three photographs on a personal Brownie camera whose fate is unknown, and told the National Enquirer eight months later that he believed both Canadian and American authorities investigated the more serious reports of this kind.
GH
Active 1975
Captain, Director of Public Affairs, 22nd NORAD Region, CFB North Bay
Confirmed the CFS Falconbridge height-finder radar's own altitude figures to the press on the record during the November 1975 incident — a target tracked 25 to 30 miles south of the station, climbing from roughly 26,000 to 45,000 feet, pausing, then to 72,000 feet — rather than declining to discuss specifics. His willingness to cite instrument data directly is a large part of why researcher Palmiro Campagna later judged contemporary press coverage of the case "essentially correct."
GP
Active 1975
Colonel, Chief of Staff of Operations, Air Defence Group & Deputy Commander of Operations, 22nd NORAD Region
Was at NORAD Headquarters in Colorado Springs when advised the CFS Falconbridge object remained in view on November 11, 1975, and personally notified Selfridge Air National Guard Base to prepare an intercept. Offered reporters a technical account of possible conventional explanations for the visual sightings at Sudbury, including unusual atmospheric effects comparable to the aurora borealis and lenticular cloud formations magnifying the apparent brightness of a star or planet.
WC
Active 1886
United States Consul, Maracaibo, Venezuela
The sole named source for the Maracaibo UFO Sighting. On November 17, 1886, Cowgill wrote a letter from the U.S. Consulate at Maracaibo describing how, on the night of October 24, 1886, a family of nine had been awakened in their rural hut by a loud humming noise and a dazzling, heatless light, and had subsequently developed radiation-like sores over a nine-day progression. Cowgill personally visited the victims at a Maracaibo hospital and described their condition as "truly horrible to behold," though not expected to be fatal. His letter, printed as "A Curious Phenomenon in Venezuela" in the December 18, 1886 issue of Scientific American, is the case's entire surviving documentary record; no further biographical detail about Cowgill beyond his consular post and this account has been located.
BW
Active 1975
Lieutenant Colonel, Director, 22nd NORAD Region Control Centre, CFB North Bay
Explained to reporters covering the November 1975 CFS Falconbridge incident why radar does not always confirm a UFO report cleanly: a target moving too slowly or too quickly, built from radar-absorbent material, or outside a set's tuned frequency can go undetected, and search radar (built to find aircraft) and height-finder radar (built to resolve altitude) serve different functions, which can leave one station's scope showing a contact that a neighboring station's does not.
JC
Oct 1, 1924 – Dec 29, 2024
39th President of the United States (1977–1981); Governor of Georgia (1971–1975)
As a private citizen and former Georgia state senator, Carter watched a bright, color-changing light for ten to twelve minutes outside the Leary, Georgia Lions Club on January 6, 1969, alongside roughly ten fellow members. He formally documented the sighting in a signed report to Hayden Hewes's International UFO Bureau on September 18, 1973 while serving as Governor, mistakenly dating the incident to "October 1969." He pledged during his 1976 presidential campaign to release government UFO information if elected, a pledge he did not fulfill in office. He consistently declined to endorse an extraterrestrial origin for his sighting for the rest of his life, while disputing skeptic Robert Sheaffer's planet-Venus identification on the basis of his own amateur-astronomy background.
Captain, Commanding Officer, 415th Night Fighter Squadron
A combat-proven Bristol Beaufighter pilot who personally shot down a Heinkel He 111 carrying German staff officers in September 1944, Augspurger commanded the 415th Night Fighter Squadron throughout the entire late-1944 "foo fighter" wave, giving institutional weight to reports filed by pilots serving directly under him. His squadron's Beaufighter, preserved and marked with his aircraft's identity, remains on public display at the National Museum of the United States Air Force.
CB
1896 – 1972
Major General, Assistant Chief of Staff for Intelligence (G-2), War Department
A decorated World War I flying ace who by 1944 served as General George C. Marshall's senior Army intelligence officer, Bissell personally sent the January 2, 1945 War Department message formally demanding an explanation for the "foo fighter" reports — direct evidence the matter had reached the most senior levels of Allied military intelligence within days of the public story breaking.
LD
fl. 1949
Sergeant, Norwood (Ohio) Police Department
Present at the pivotal October 23, 1949 sighting of the Norwood Searchlight Incident, Davidson produced the case's entire surviving photographic and film record — still photographs and three 25-foot reels of 16mm black-and-white motion picture film shot with a borrowed Hugo Meyer f/1.9 camera. Popular retellings of the case have sometimes mislabeled him Norwood's police chief; the documented record identifies him only as a sergeant. None of his original negatives or film reels are known to survive today.
ET
fl. 1949
Mayor of Norwood, Ohio
Norwood's sitting mayor personally witnessed the December 20, 1949 sighting in the Norwood Searchlight Incident and went on record describing visible "ridges or ribbing" on the object's surface — the case's most specific structural detail, lending the sighting an unusual degree of institutional credibility for a small-city nocturnal-light report, though his account was never independently corroborated by another named witness at that specific sighting.
JG
fl. 2011
Processing Archivist, National Archives (Archives II)
While cataloguing routine Vietnam War-era U.S. Army unit paperwork held in Record Group 472, Gillette discovered a January 6, 1969 daily journal entry from the 23rd Infantry (Americal) Division's Chu Lai Defense Command describing an egg-shaped, glowing object landing near the base's ammunition supply point. He published the find on NARA's own official history blog, The Text Message, on June 6, 2011, under the title "No Enemy Contact, but Alien Contact…," weighing (and finding inconclusive) several conventional explanations before concluding that "the truth may be out there, but it isn't in these records." Not himself a witness to the 1969 event, Gillette is the sole reason the case is documented outside the National Archives' own physical holdings. See the Chu Lai Egg-Shaped Object Incident case file.
Director, All-domain Anomaly Resolution Office (AARO), U.S. Department of Defense (2024–present)
A physicist and mathematician who spent most of his career in technical and leadership roles within the National Security Agency's Research Directorate — including work as a Free Space Optics subject-matter expert and a graduate of NSA's Cryptanalysis Development Program — Kosloski holds a Ph.D. in Electrical Engineering from Johns Hopkins University, where his doctoral research applied quantum-optics principles to weak-signal receiver design. He was named AARO's second director in August 2024. In November 2024, Kosloski previewed AARO's findings on the 2013 Aguadilla FLIR video in testimony before the Senate Armed Services Committee, describing the object as "likely a pair of balloons or sky lanterns" and explaining the apparent water entry as a thermal-contrast illusion; AARO's formal case resolution report followed in March 2025.
AJ
fl. 2008
Control Room Inspector, South Wales Police
The South Wales Police control room inspector quoted in the force's June 2008 response to press coverage of the St Athan police helicopter sighting, offering a far more measured framing than The Sun's dramatized "UFO attack" account: that in today's skies there is a wide range of aircraft of different shapes and sizes, and that, in all probability, the crew's sighting had simply confirmed one such aircraft was in the area at the time. Her statement, alongside the force's parallel denial that any pursuit or danger to the crew had occurred, became a central point of the case's own internal contradiction between tabloid framing and official record.
PS
Community Relations Officer, Ministry of Defence (Wales)
The Ministry of Defence's community relations officer for Wales in June 2008, who told the South Wales Echo that nobody from the MoD had been present at MOD St Athan when the police helicopter sighting occurred and that the department "couldn't find any information about it," adding that he "would really like to know the truth of the story" — a candid admission that the MoD's own desk held no independent record of an incident South Wales Police said it had reported through official channels.
RJ
fl. 1964–2025
1st Lieutenant, USAF; Officer-in-Charge, Photo-Optical Instrumentation, 1369th Photographic Squadron
In fall 1964, Jacobs oversaw a telescope-and-camera tracking team stationed near Anderson Peak, Big Sur to film an Atlas missile reentry-vehicle test launched from Vandenberg Air Force Base. He has maintained since going public in a 1982 National Enquirer article that the footage showed a disc-shaped object circling the dummy warhead and firing beams of light at it moments before it tumbled off course — an account base engineer Kingston George disputes as a misidentified decoy/chaff release. Jacobs went on to earn a Ph.D. in dramatic art from UC Santa Barbara and became a professor in the Communication Department at Bradley University, co-authored Confession: Our Hidden Alien Encounters Revealed (2019) with researcher Robert Hastings, and was still publicly disputing the government's characterization of the case, including AARO's 2024 review, as of a 2025 public statement. See the full Vandenberg AFB case file for the complete, contested chronology.
Major, USAF; photo interpreter, Vandenberg Office of the Chief Scientist
Mansmann reviewed the disputed 1964 tracking film frame-by-frame at Vandenberg's Office of the Chief Scientist and, according to Robert Jacobs, screened it for him in his office in the presence of two or three unidentified men in plain suits before instructing Jacobs never to describe it as a UFO again. In letters to researchers between 1983 and 1987, Mansmann corroborated seeing a disc-shaped object with a raised, glowing dome in the footage, though he did not personally operate the camera and his account has itself become a central, closely scrutinized piece of evidence in the case.
KG
fl. 1961–2009
Physicist/Engineer; USAF civilian operations analyst and project engineer, Vandenberg AFB (1961–1990)
A nationally recognized expert on optical, radar, and telemetry tracking systems who worked at Vandenberg Air Force Base from 1961 until retiring in 1990 as chief of safety in Santa Maria, California, George was the project engineer for the same 1964 Atlas reentry-vehicle test Robert Jacobs says his camera team filmed a UFO disabling. In two Skeptical Inquirer articles (1993, 2009), George argued the footage actually showed ordinary decoy reentry vehicles and radar-defeating chaff separating from the real warhead, and that Jacobs, lacking full clearance on the test's classified penetration-aid package, misread a known countermeasure as an intelligently controlled craft. Researcher Robert Hastings has published a detailed rebuttal disputing George's account of when and how he says he viewed the film.
BS
Second Lieutenant, USAF; Project Blue Book Field Investigator
The Air Force officer dispatched to investigate the October 26, 1958 sighting at Loch Raven Dam near Towson, Maryland. After interviewing witnesses Alvin Cohen and Phillip Small, Staples concluded in his report that, given their apparent credibility, "it can be assumed that the sighting did actually occur" — while still forwarding the case to Project Blue Book as unidentified rather than proposing a specific conventional cause.
Baillie & Independent Councillor, Falkirk Council (Bonnybridge/Larbert Ward)
Beginning in 1992, Buchanan started collecting UFO reports from Bonnybridge-area constituents on his own initiative, logging more than 200 separate incidents by the end of that first year alone. He has since traveled to London to petition successive UK Prime Ministers — including John Major, Tony Blair, and David Cameron — for a formal government investigation into the town's ongoing sightings, without success. In a 2024 TalkTV documentary, former MoD UFO-desk officer Nick Pope personally apologized to Buchanan and the people of Bonnybridge for the Ministry's historical dismissal of their reports; Buchanan publicly rejected the apology, calling Pope an "agent provocateur" still effectively working for the government.
KR
Active 1979–1980
Former FBI Agent; Director, 1979 New Mexico Cattle Mutilation Investigation
Led a federally funded, roughly $44,000 investigation ("Operation Animal Mutilation") into New Mexico livestock deaths, funded by the Law Enforcement Assistance Administration. In a March 1980 letter to the FBI, Rommel concluded that "most credible sources have attributed this damage to normal predator and scavenger activity," noting that "no factual data" supported competing UFO or government-conspiracy theories, while acknowledging a residual minority of cases he could not fully explain. His conclusions are cited in this site's Mutilation of Snippy the Horse file as directly relevant to the broader phenomenon that case is credited with launching.
HR
1939 – 2021
U.S. Senator, Nevada (1987–2017); Senate Majority Leader (2007–2015)
Personally organized the classified ~$22 million congressional appropriation that created the Advanced Aerospace Weapon System Applications Program (AAWSAP) and its Pentagon-internal successor, AATIP, after his longtime friend Robert Bigelow told him a Defense Intelligence Agency official had approached him about UAP research. Recruited fellow appropriations subcommittee members Ted Stevens and Daniel Inouye to fund the effort as "black money" without a public Senate floor debate. Gave an unusually candid on-record 2017 interview defending the program ("I'm not embarrassed or ashamed or sorry I got this thing going") while cautioning against overclaiming its findings ("We do not know").
SP
Active 2015–present
Aerospace Engineer, Naval Air Warfare Center Aircraft Division (NAWCAD)
Navy aerospace engineer who filed a series of patents between 2015 and 2019 describing exotic propulsion and power concepts, most notably "Craft Using an Inertial Mass Reduction Device" (granted as US10144532B2 in 2018) and "High-Frequency Gravitational Wave Generator" (US10322827B2). His patents describe using a resonant electromagnetic cavity to create a "local polarized vacuum" around a craft, reducing its effective inertial mass. NAWCAD's own roughly three-year, $508,000 internal test program (2016–2019) could not substantiate the underlying "Pais Effect." See this site's Vacuum Polarizability theory file for the full patent and test-program history.
US10144532B2 NAWCAD Pais Effect
GF
1913 – 2006
U.S. House Minority Leader (Michigan's 5th District); later 38th President of the United States
As House Minority Leader in March 1966, Ford publicly rejected Dr. J. Allen Hynek's "swamp gas" explanation for the Michigan UFO wave as "flippant" and formally called for "a full-blown investigation," directly producing the April 5, 1966 House Armed Services Committee hearing — the first open Congressional hearing on UFOs in American history. He would go on to become the 38th President in 1974, making this one of the earliest instances of a future U.S. president taking a public, on-the-record position on UFO policy.
WV
1924 – 2020
U.S. Representative, Michigan's 2nd District (1965–1967)
An electrical engineer and one of the "Michigan Five Fluke Freshmen" elected in the 1964 Democratic wave, Vivian represented the Ann Arbor/Dexter area and formally requested Air Force/Project Blue Book assistance after the March 1966 sightings began. He joined Gerald Ford in calling for a Congressional hearing, though he lost his re-election bid later that year.
DH
fl. 1966 – 2017
Sheriff, Washtenaw County, Michigan
Commanded the twelve-officer law-enforcement response to the Dexter sighting and personally toured the swamp with Dr. J. Allen Hynek during his investigation. Harvey maintained for decades afterward that Hynek privately expressed genuine uncertainty ("There is something. We just can't put our finger on it") before a phone call to Washington preceded the public "swamp gas" statement. Interviewed again in 2017, more than fifty years later, he told a reporter: "They did see something. I'll believe this to the day I die."
Civil Defense Director, Hillsdale County, Michigan
Called to the Hillsdale College campus by McIntyre Hall residents on the night of March 21, 1966, Van Horn personally observed the object through binoculars for hours and became the case's most persistent institutional critic of Dr. Hynek's investigation, publishing a detailed fifteen-point rebuttal: "It was my considered opinion that Dr. Hynek had his mind made up as to what his findings would be before he ever reached the City of Hillsdale."
RT
Chief of Police, Dexter, Michigan
Among the first law-enforcement officers to respond to Frank Mannor's report on the night of March 20, 1966, Chief Taylor personally observed the hovering object from the Mannor farm alongside Patrolman N.G. Lee, corroborating the sighting independently of the Mannor family.
SM
Deputy Sheriff, Washtenaw County, Michigan
Dispatched by Sheriff Douglas Harvey on the night of March 20, 1966, McFadden and fellow Deputy David Fitzpatrick went on foot into the Dexter swamp itself to investigate the object at close range, among the twelve sworn officers present that night.
DF
Deputy Sheriff, Washtenaw County, Michigan
On March 16, 1966, Fitzpatrick and Sergeant Nuel Schneider spent nearly four hours photographing lights over Milan with a tripod-mounted camera; Dr. J. Allen Hynek later identified the resulting images as the Moon and Venus — one of the few pieces of the entire Michigan flap independently confirmed as celestial misidentification. Four days later, Fitzpatrick was among the twelve officers who responded to the Frank Mannor sighting at Dexter.
JR
1920 – 2011
U.S. Representative (D-Indiana)
A seven-term Indiana congressman on the House Committee on Science and Astronautics who chaired its July 29, 1968 "Symposium on Unidentified Flying Objects," inviting six scientists — including J. Allen Hynek, James E. McDonald, and Carl Sagan — to testify before Congress on the UFO problem and the still-unreleased Condon Report. After the report's public conclusions drew sharp criticism from several of his invited witnesses, Roush called for a General Accounting Office investigation into the study's conduct; the request was declined.
SG
Active 2019–2022
U.S. Department of Defense spokesperson
Pentagon press spokesperson who, in May 2021, issued the Department of Defense's on-record confirmation that the leaked USS Omaha footage "was taken by Navy personnel" and that "the UAPTF included it in their ongoing examinations." Her carefully bounded statements — confirming the footage's provenance while declining to characterize the objects themselves as unknown, unidentified, or otherwise — became the template for subsequent Pentagon responses to the wave of Corbell/Knapp leaks through 2021 and 2022.
CB
fl. 1957 – 1958
Capitão-de-Corveta (Lieutenant Commander), Commander, Brazilian Navy Trindade Task Force
Commander of the Brazilian Navy task force occupying Trindade Island for International Geophysical Year research, Bacellar personally ordered Almiro Barauna's film developed under guard in a converted onboard washroom within hours of the sighting and later authorized the photographs' public release. His own written report on the development, declassified decades later, describes something more equivocal than the confident "flying saucer" the Navy allowed into print: he recorded seeing only a "strange stain" (estranha mancha) on three of the four negatives immediately after development, adding that it was "later perfectly identified" — a phrase read by different researchers as either routine confirmation or a telling hedge. He also later permitted Barauna to disembark at Vitória with the negatives still in his personal possession, breaking the chain of custody the Navy's own security procedures had been designed to protect.
EE
USAF Major; Commander, 1608th Security Police Squadron
Commanded the 1608th Security Police Squadron responsible for guarding the Manzano Weapons Storage Area during the August 1980 sighting wave. After civilian investigator Paul Bennewitz approached him on October 24, 1980 with concerns about a possible threat to the nuclear-weapons storage site, Edwards directed his security personnel to continue reporting unusual aerial activity — a request that helped draw AFOSI agent Richard Doty formally into the case.
Case File #116 1608th SPS Manzano
SF
USAF Staff Sergeant; Area Supervisor, 1608th Security Police Squadron
The senior of three security policemen who, on the night of August 8, 1980, reported a very bright light traveling with great speed before stopping suddenly in the sky over Coyote Canyon near the Manzano Weapons Storage Area, then departing vertically at high speed. His report, filed alongside two subordinates, ATC Martin W. Rist and Amn Anthony D. Frazier, forms the documented starting point of the AFOSI complaint file.
Case File #116 1608th SPS Aug 8, 1980
MR
USAF Air Traffic Controller, 1608th Security Police Squadron
One of three security policemen on duty in the Manzano Weapons Storage Area's Charlie Sector on the night of August 8, 1980, alongside SSgt Stephen Ferenz and Amn Anthony D. Frazier, who together reported a fast-moving bright light stopping and hovering over Coyote Canyon before departing vertically at high speed.
Case File #116 1608th SPS Aug 8, 1980
AF
USAF Airman, 1608th Security Police Squadron
One of three security policemen on duty in the Manzano Weapons Storage Area's Charlie Sector on the night of August 8, 1980, alongside SSgt Stephen Ferenz and ATC Martin W. Rist, whose joint report anchors the primary AFOSI complaint file for the case.
Case File #116 1608th SPS Aug 8, 1980
JM
active 1980
Chief Scientific Advisor, Air Force Test and Evaluation Center, Kirtland AFB; former Project Blue Book field investigator
A former Project Blue Book investigator at Wright-Patterson AFB, Miller joined AFOSI agent Richard Doty on October 26, 1980 to interview civilian investigator Paul Bennewitz and examine his films and audio recordings of activity near the Manzano Weapons Storage Area. Miller concluded the footage "clearly shows that some type of unidentified aerial objects were caught on film," while finding the accompanying electronic tape recordings inconclusive and reaching no determination on whether the objects posed any actual threat to the weapons-storage site.
Case File #116 Project Blue Book Bennewitz
RM
20th century
Commander, U.S. Navy; Guided-Missile Liaison Officer, White Sands Proving Ground
Navy guided-missile liaison officer stationed at White Sands Proving Ground who authored a Department of Defense-cleared account of his own White Sands-area disk sightings, published as "How Scientists Track Flying Saucers" in True magazine in March 1950. In a May 12, 1949 letter to physicist James Van Allen, McLaughlin relayed that Clyde Tombaugh had told him of a bright flash Tombaugh observed on Mars on August 27, 1941, which Tombaugh had by then come to associate with the possibility of an atomic detonation — an aside unrelated in substance to Tombaugh's own August 1949 sighting later that summer.
Lieutenant, Voronezh District Police
A Voronezh district police lieutenant who told New York Times reporter Esther B. Fein that he had personally observed "a body flying in the sky" over the city around the time of the reported landing, making him the case's only uniformed law-enforcement witness. Matveyev was careful to distinguish what he had and had not seen, explicitly stating that while he believed he had witnessed the object itself, he had not seen any entities — a specific, limited claim that gives his testimony more evidentiary weight than the more elaborate child accounts, even as it falls well short of confirming the landing, the robot, or the beings.
MG
CNO 2019–2023
Admiral, U.S. Navy; Chief of Naval Operations
As the Navy's top uniformed officer, Gilday was asked directly at an April 2021 Defense Writers Group event in Washington whether the Navy had identified the drones that had swarmed the USS Kidd, USS Rafael Peralta, and other destroyers off Southern California in July 2019. His on-record answer — "No, we have not" — became the case's single most widely quoted official acknowledgment. He added that he had "no indications at all" the objects were extraterrestrial, while confirming the incidents remained under analysis through standard joint-force collection channels.
2019 Navy Destroyer Drone Swarm Chief of Naval Operations
SB
Active 2022
Deputy Director of Naval Intelligence
Testified before the House Intelligence Subcommittee on Counterterrorism, Counterintelligence, and Counterproliferation on May 17, 2022 — the first open congressional UAP hearing in over 50 years. Bray presented the leaked night-vision "triangle" footage filmed aboard the USS Russell during the 2019 drone-swarm incidents and told the panel the Pentagon was "reasonably confident" the triangular shapes were unmanned aerial systems, with the triangle appearance itself produced by light passing through night-vision goggles and being recorded by an SLR camera (a bokeh/aperture artifact). He also stated the Pentagon had detected no emanations suggesting a non-terrestrial origin for any case reviewed, while acknowledging the operators and origin of the 2019 drones themselves were never identified.
2019 Navy Destroyer Drone Swarm House UAP Hearing, May 2022
JA
Retired U.S. Army Colonel, PhD
A decades-long figure in U.S. military-adjacent paranormal and non-lethal-weapons research. Interviewed Chris Bledsoe in 2015, reports personally witnessing a luminous object near Bledsoe's original 2007 encounter site, and wrote the introduction to Bledsoe's book UFO of GOD. Introduced Bledsoe to remote viewer Joseph McMoneagle and, through that network, to Jim Semivan.
JS
Active since 1980s
Former CIA Senior Intelligence Service Officer
Spent 25 years in the CIA's clandestine service before becoming a public figure in Tom DeLonge's To The Stars Academy. Wrote the foreword to Chris Bledsoe's book UFO of GOD and has become one of the case's most consistent public endorsers, framing his own sustained personal interest as evidence the government "listened" to Bledsoe for nearly two decades.
Chris Bledsoe John B. Alexander To The Stars Academy
JM
U.S. Army Stargate Remote Viewer #001 (Ret.); Legion of Merit
The U.S. Army's first designated remote viewer under the Stargate program run out of SRI International. Introduced to Chris Bledsoe via John B. Alexander, and participated in the disputed 2015 remote-viewing session Bledsoe connects to a warning about Pope Francis's safety — a claim independent researchers later found to be chronologically impossible as told.
BD
Active 2000s
Retired FBI Polygraph Examiner
Administered MUFON's 2008 polygraph examination of Chris Bledsoe, which reportedly indicated deception on some answers — a result investigators attributed to lingering psychological trauma rather than dishonesty, though no independent clean-pass polygraph on the case's core claims has since been produced.
SG
Active 2020s
Astrophysicist; former UAP Task Force imagery scientist
A former intelligence-community imagery scientist and nuclear analyst who served with the U.S. government's UAP Task Force. Filmed alongside Chris Bledsoe during a widely discussed 2025 sighting over Washington, D.C., later discussed with Ross Coulthart on NewsNation's Reality Check.
AB
Former Covert CIA Intelligence Officer; Founder, EverydaySpy
A former CIA covert operations officer who spent seven years in mission planning and coordination before founding the EverydaySpy training platform. Serves as an on-air investigator for History Channel's Beyond Skinwalker Ranch, including the 2023 episode profiling Chris Bledsoe and a 2025 follow-up segment incorporating EEG testing at the Monroe Institute.
SR
b. 1982
Former Navy SEAL & CIA Contractor; Podcast Host
A former Navy SEAL and CIA Global Response Staff contractor who hosts The Shawn Ryan Show, one of the most-listened-to podcasts in the U.S. His nearly three-hour February 2025 interview with Chris Bledsoe ("The Episode We Never Censored") substantially widened Bledsoe's mainstream audience.
JY
Polygraph Examiner, Lexington Police Department
A professional polygraphist and self-described prior UFO skeptic, Young administered separate lie-detector examinations to Louise Smith, Mona Stafford, and Elaine Thomas on July 23, 1976, finding no indication of deception in any of the three. His own written report candidly flagged that MUFON investigators had shown the women standardized entity sketches before they produced their own drawings or underwent hypnosis — a methodological weakness he identified as one skeptics would be justified in citing against the investigation.
LW
Active 1959
FAA Flight Service Specialist, Redmond Airport (Roberts Field)
On duty at the Redmond, Oregon FAA Flight Service Station, Wertz had just completed a routine weather observation, noticing nothing unusual, when Officer Robert Dickerson arrived reporting an unidentified object. Wertz and other FAA personnel then observed it directly through binoculars for close to an hour, describing it as round and flat with intermittent flame-like projections from its rim. Wertz's formal report to Seattle Air Route Traffic Control Center at 5:10 a.m. set the entire six-F-102 military response in motion.
BW
Active 1959
Technical Field Office Chief, Federal Aviation Administration
FAA official whose October 1, 1959 public statement attributing the Redmond, Oregon sighting to the planet Venus became the case's lasting official explanation, after earlier Air Force explanations involving a denied radar contact, a weather balloon, and a stationary "gap filler" radar antenna reflection had each been raised and abandoned. Wolfe separately held administrative oversight of a nearby International Geophysical Year all-sky camera whose automated filming had reportedly stopped roughly an hour before the sighting began.
Investigating Officer, Brazilian Army
The Brazilian Army colonel who led the internal administrative inquiry (sindicância) ordered in May 1996 at the Escola de Sargentos das Armas, interviewing 23 military personnel over eight days about press claims of a creature-transport operation and concluding the named personnel had not participated in any such operation — the first of the Varginha case's two formal military investigations.
EB
Active 2023 – present
U.S. Representative (R-MO); House Oversight Committee, Task Force on the Declassification of Federal Secrets
Missouri congressman who attended the January 15, 2026 closed-door Congressional meeting with Varginha witnesses and, in July 2026, formally requested that CIA Director John Ratcliffe and FBI Director Kash Patel disclose any American government records or investigative equities tied to the January 1996 Varginha/Campinas incident, after hearing testimony from Brazilian witnesses and physicians.
BR
Captain, Copilot, B-52H JAG-31, 5th Bombardment Wing, USAF
Effectively in command of the B-52 after the aircraft commander withdrew to the bunk area during the October 24, 1968 Minot Air Force Base UFO incident, Runyon gave the case's single most detailed direct visual account of any structured object in this archive's Blue Book-era files, describing a metallic cylindrical section and internally lit green and yellow coloring during a low pass. His interview with researcher Thomas Tulien in May 2000 became the seed of the case's most detailed independent investigation.
PM
Active 1968
Captain, Navigator, B-52H JAG-31, 5th Bombardment Wing, USAF
The most extensively quoted crew member in the October 24, 1968 Minot Air Force Base UFO incident, McCaslin directed the radar navigator to Station Keep mode, tracked the anomalous return through the B-52's 180-degree turn and its instantaneous one-mile closure, and later rejected Blue Book's proposed Vega explanation on geometric grounds: "This thing was at or near the ground. How could it be a star if you're looking at the ground?"
CR
Major, Radar Navigator, B-52H JAG-31, 5th Bombardment Wing, USAF
Operating the B-52's AN/ASB-16 radar during the October 24, 1968 Minot Air Force Base UFO incident, Richey produced the return navigator Patrick McCaslin described as "as big or bigger than a KC-135" and activated the 35mm radarscope camera that recorded fourteen surviving frames of film, the case's single strongest piece of instrumented evidence.
JP
Active 1968
Major, Evaluation Pilot, B-52H JAG-31, 5th Bombardment Wing, USAF
Aboard to assess crew proficiency during the October 24, 1968 Minot Air Force Base UFO incident, Partin found himself effectively sharing command of the aircraft and was one of two pilots who visually observed the stationary, glowing object during the low overflight. His signed AF-117 statement describes "a miniature sun placed on the ground below the aircraft," and he was the first crew member formally debriefed at Base Operations after landing.
AW
Active 1968
Lieutenant Colonel, Investigating Officer, 862nd Combat Support Group, Minot AFB
Designated under Air Force Regulation 80-17 to investigate the October 24, 1968 Minot Air Force Base UFO incident, Werlich compiled a 145-page report forwarded to Project Blue Book and explicitly identified four occurrences as unexplained at his level, even as his own timeline, message traffic, and witness-interview technique later drew documented criticism from independent researcher Thomas Tulien.
HQ
1923 – 1998
Lieutenant Colonel, Chief, Project Blue Book, Foreign Technology Division, Wright-Patterson AFB
Headed Project Blue Book from 1963 to 1969 and issued the final case dispositions on some of the era's most contested reports, including Minot Air Force Base (November 13, 1968), where he attributed the radar and radio anomalies to "plasma similar to ball lightning" and the visual sightings to the stars Sirius and Vega. His own acknowledgment that "two hours is too long to make an accurate report" is frequently cited as evidence of Blue Book's institutional limits in evaluating extended, multi-witness cases.
RB
CEFAA Director, 1997–2016
Founding Director, Comité de Estudios de Fenómenos Aéreos Anómalos (CEFAA), Chile
A retired Chilean Air Force brigadier general who led CEFAA, the Chilean government's official UAP investigative body under its civil aviation authority, from its founding in October 1997 until 2016. Bermúdez oversaw the roughly two-year, multi-disciplinary review of the November 2014 Chilean Navy helicopter FLIR video and announced its findings publicly in January 2017, stating, "We do not know what it was, but we do know what it was not." His committee's official finding — that the object should be classified an unresolved Unidentified Aerial Phenomenon — has never been formally revised, despite a technically rigorous conventional explanation developed independently within days of the release.
SP
Local Militia (Police) Officer, Poland
Conducted the Emilcin case's first formal investigation on behalf of local Communist-era authorities in mid-May 1978 and publicly concluded, without psychological or medical evaluation, that Jan Wolski had "fallen asleep and dreamed everything" — the case's earliest and least rigorously supported conventional-explanation hypothesis.
Former Militia (Police) Officer, Poland
A former militia officer whose later critique of the Emilcin investigation specifically identified the failure to check regional military helicopter and aircraft flight logs as an unaddressed investigative gap in Zbigniew Blania-Bolnar's original inquiry.
Argentine Navy, UFO-Analysis Desk
Conducted an early official Argentine Navy inquiry into the Trancas Case in late 1963, a genuinely unusual instance of formal military engagement with a civilian UFO report in 1960s Argentina.
CB
Active 1975
Wing Commander, Wurtsmith AFB
The ranking officer who, on being notified of the weapons-storage-area report on October 30, 1975, ordered an inbound KC-135 tanker to attempt to intercept and identify the object. First name not given in any source consulted.
JD
Vice Commander, 379th Bombardment Wing, Wurtsmith AFB
Named in the surviving record in connection with the base's official response to the October 30, 1975 intrusion, lending command-level accountability to how the incident was handled and reported.
FP
KC-135 Aircraft Commander, Wurtsmith AFB
Commanded the KC-135 tanker directed by Radar Approach Control to pursue the object over Lake Huron on October 30, 1975.
KM
KC-135 Co-Pilot, Wurtsmith AFB
Part of the five-officer KC-135 crew that visually tracked the object(s) during the October 30, 1975 intercept attempt.
RM
KC-135 Navigator, Wurtsmith AFB
The tanker's navigator during the October 30, 1975 pursuit, part of the crew corroborating the object's reported course, position, and departure.
MT
KC-135 Instructor Navigator, Wurtsmith AFB
Author of the case's single most quoted eyewitness line: "we determined that there were in fact two objects and the irregular flashing appeared to be some sort of signal." His presence as an instructor navigator adds a trained, evaluative layer to the sighting.
KC-135 Instructor Pilot, Wurtsmith AFB
The instructor pilot aboard the KC-135 that pursued the object on October 30, 1975, part of the unusually large five-officer crew present for the intercept.
RC
Colonel, Commander, 42nd Bomb Wing, Loring AFB
Personally responded to Loring's weapons storage area on the night of October 27, 1975 and declared a Security Option 3 alert — the base's highest local response short of a full base-wide emergency — then requested the Army National Guard helicopter search that followed. His decision to escalate is one of the case's clearest institutional signals that Loring's own command structure treated the intrusion as a credible security concern.
BP
Active 1975
Chief Warrant Officer, Helicopter Pilot, Maine Army National Guard
Piloted the federalized UH-1 helicopter, launched from Bangor, that flew repeated roughly 40-minute search sorties beginning October 29, 1975, with Eugene Herrin as co-pilot and RCMP, Maine State Police, and Air Security personnel aboard. Despite being vectored by ground radio operators toward the object's reported position, the crew never achieved visual contact. Poulin was later interviewed at length by researchers Lawrence Fawcett and Barry Greenwood for Clear Intent.
EH
Active 1975
Chief Warrant Officer, Helicopter Co-Pilot, Maine Army National Guard
Co-piloted the UH-1 helicopter search missions at Loring AFB alongside Bernard Poulin beginning October 29, 1975, flying repeated sorties vectored by ground radio operators without ever achieving visual contact with the object other personnel were simultaneously reporting.
CR
Active 1975
Brigadier General, Deputy Director for Operations, National Military Command Center
Reviewed and approved Loring AFB's escalating response to the October 1975 intrusions from the National Military Command Center at the Pentagon, including authorizing the federalized Army National Guard helicopter search under specific tracking-only, no-apprehension constraints.
MS
Major General, Director of Operations, Department of the Army
Named in the National Military Command Center message traffic reviewing Loring AFB's October 1975 intrusion reports alongside C.D. Roberts Jr. and Colonel Bailey.
CB
Active 1975
Colonel, Military Aide to the Special Assistant to the Secretary and Deputy Secretary of Defense
Named in the National Military Command Center message traffic reviewing Loring AFB's October 1975 intrusion reports alongside C.D. Roberts Jr. and Maj. Gen. Sniffin.
DL
Retired French Air Force General; Chairman, COMETA
A retired French Air Force general whose career included fighter squadron command flying Mirage III and Mirage F1 aircraft, service as commander of Strasbourg Air Base, air operations command during French military operations in Chad and Mauritania, and a posting as chief of the French military mission to NATO allied forces at Ramstein. As an auditor of the Institut des Hautes Études de Défense Nationale (IHEDN), Letty co-founded and chaired COMETA (Comité d'Études Approfondies), the private committee of roughly thirty former generals, admirals, engineers, and officials that produced the 1999 report Les OVNI et la Défense: À quoi doit-on se préparer? Letty led the three-year research effort and signed the report's principal acknowledgments and conclusions, which controversially favored the extraterrestrial hypothesis as the most probable explanation for a residual category of well-documented, unexplained cases. He has continued to defend the report's seriousness and its authors' credentials against characterizations of COMETA as a fringe or unqualified body.
BN
French Air Force General (ret.); Former Director, IHEDN
A retired French Air Force general and former director of the Institut des Hautes Études de Défense Nationale (IHEDN), the state defense-studies institute at the École Militaire in Paris from which most of COMETA's membership was drawn. Norlain wrote the foreword to the 1999 COMETA report, endorsing the seriousness of its authors' collective credentials in defense, industry, research, and government administration, and expressing hope that its recommendations for closer official French engagement with the UAP question would be examined by the government.
AL
1932 – 2011
Former President, CNES (France's National Space Agency)
A former president of CNES, France's national space agency, who wrote the scientific preamble to the 1999 COMETA report. Lebeau argued that a collectively and reliably observed phenomenon — however rare or strange — is a legitimate object of scientific study regardless of a researcher's personal beliefs about its ultimate cause, framing COMETA's methodological approach to case analysis as consistent with ordinary scientific practice rather than an exceptional or credulous one.
JR
Commander-in-Chief, FACh, 2010–2014
General del Aire; Commander-in-Chief, Fuerza Aérea de Chile
Formally promoted to General del Aire and appointed Commander-in-Chief of the Chilean Air Force on November 5, 2010, replacing Gen. Ricardo Ortega Perrier in a change-of-command ceremony at El Bosque Air Base. The flyover held in his honor — performed by the Halcones aerobatic team and formations of F-5 and F-16 fighters — is the footage in which seven attendees independently recorded the anomalous object at the center of the El Bosque UFO case. His own documented appointment date is the strongest independent evidence resolving a one-day discrepancy in Chilean press coverage of the incident's date.
SP
1949 – 2024
President of Chile, 2010–2014 & 2018–2022
President of Chile, in office less than a year when he attended the November 5, 2010 Chilean Air Force change-of-command ceremony at El Bosque Air Base alongside the commanders of Chile's other armed services. As with every other attendee, Piñera has never been reported to have personally noticed the object later identified in seven attendees' video footage — the anomaly was discovered only in retrospective video review, days after the ceremony he attended in person.
AG
French Resident-General of Morocco, 1951–1954
The French Resident-General administering the protectorate of Morocco throughout the entire period covered by UFO Sightings Over Morocco and French West Africa, having taken office in August 1951. Guillaume presided over Morocco's colonial administration during the exact rise in nationalist tension that culminated in the December 1952 Casablanca riots and, the following year, his own role in Sultan Mohammed V's exile to Madagascar.
BC
High Commissioner of French West Africa, 1951–1956
The senior French colonial administrator governing the entire French West Africa federation from Dakar throughout the period covered by UFO Sightings Over Morocco and French West Africa, including the July 3, 1952 Dakar sighting. Cornut-Gentille had previously served as High Commissioner in French Equatorial Africa before his 1951 appointment to the larger AOF post.
Captain, USAF; Missile Combat Crew Commander, F.E. Warren AFB
A Minuteman missile combat crew commander on duty in an underground launch control capsule at F.E. Warren Air Force Base during the multi-hour UFO wave of August 1, 1965. In later interviews with Robert Hastings, Earnshaw described objects "stacked up, one on top of the other" over the missile field — corroborating, from a separate launch control capsule, the same overnight pattern of sightings reported by base commander Colonel Johnson and security personnel at Quebec Flight.
ICBM Launch Officer, USAF, F.E. Warren AFB
A Minuteman missile launch officer on duty at a separate underground launch control capsule from Jay Earnshaw during the August 1, 1965 sighting wave at F.E. Warren Air Force Base. Tashner independently confirmed to researcher Robert Hastings that unidentified objects, described as oblong or disc-shaped and reddish-orange in color, were observed maneuvering over the missile field that night.
Airman 2nd Class, USAF; 809th Combat Defense Squadron
A security policeman assigned to the 809th Combat Defense Squadron at F.E. Warren Air Force Base, Thompson was on duty near the Quebec Flight launch control facility on August 1, 1965, when he and fellow airman Terry Stuck observed eight stationary lights arranged in four pairs overhead, one of which appeared to move independently of the others. Thompson later recalled: "I wasn't sure what we were seeing until I reported back to the launch commander. When he told me of the report of UFOs from Cheyenne Mountain, I could tell by his voice that he wasn't joking" — a reference to NORAD's independent radar track of the same formation.
Airman 2nd Class, USAF; 809th Combat Defense Squadron
Serving alongside Robert R. Thompson in the 809th Combat Defense Squadron, Stuck co-witnessed the formation of eight lights near Quebec Flight's launch control facility at F.E. Warren Air Force Base in the early hours of August 1, 1965, a sighting independently corroborated by a NORAD Cheyenne Mountain radar report relayed to the base the same night.
Duty Officer, Project Blue Book, Wright-Patterson AFB
The Project Blue Book duty officer at Wright-Patterson Air Force Base, Ohio, who fielded and logged the sequence of telephone reports arriving from F.E. Warren Air Force Base personnel beginning at 1:30 a.m. on August 1, 1965. Anspaugh's own contemporaneous memorandum summarizing those calls — including reports from Colonel Johnson, Capt. Snelling, and Colonel Williams — survives only because civilian scientific consultant J. Allen Hynek published it in his 1972 book The UFO Experience: A Scientific Inquiry, making it the case's single most important primary document.
Captain, USAF Command Post, Cheyenne, Wyoming
The Air Force Command Post officer near F.E. Warren Air Force Base who placed the first call of the night to Project Blue Book duty officer Lt. Anspaugh at 1:30 a.m. on August 1, 1965, reporting that a local radio station had received 15 to 20 calls from Cheyenne residents describing a large circular object emitting several colors but no sound over the city.
Captain, USAF Command Post, Cheyenne, Wyoming
A second Air Force Command Post officer near F.E. Warren Air Force Base who relayed follow-up reports to Project Blue Book duty officer Lt. Anspaugh as the August 1, 1965 sighting wave continued into the early morning hours, part of the same call chain documented in the surviving Blue Book memorandum alongside Capt. Snelling.
Colonel, USAF; Base Commander, F.E. Warren Air Force Base
Commander of F.E. Warren Air Force Base in 1965, Johnson personally telephoned Project Blue Book at Wright-Patterson AFB during the overnight sighting wave of August 1, reporting that the commanding officer of the Sioux Army Depot, Colonel Williams, had independently seen five objects at 1:45 a.m., and that Q (Quebec) Flight had reported nine unidentified objects — four to the northwest, three to the northeast, and two over the city of Cheyenne — around 4:00 a.m. That a base commander made the report himself, rather than routing it through a subordinate, is one of the case's more unusual institutional details.
Colonel, U.S. Army; Commanding Officer, Sioux Army Depot
Commanding officer of the Sioux Army Depot near Sidney, Nebraska, roughly 40 miles from F.E. Warren Air Force Base. Williams personally observed five unidentified objects at approximately 1:45 a.m. on August 1, 1965, a report relayed to Project Blue Book by base commander Colonel Johnson — independent corroboration, from a separate Army installation under separate command, of the same overnight wave affecting Warren's missile field.
Airman 1st Class, USAF; 809th Combat Defense Squadron
A security airman guarding an Atlas missile site (Site 1, Pad 1) at F.E. Warren Air Force Base in August 1964, roughly a year before the base's much larger 1965 sighting wave. McEnaney reported a bright, round object hovering over the pad; Denver-based interceptors were scrambled, and the Air Force's official explanation was a weather balloon. McEnaney later said he and other witnesses "were later told to keep quiet about it as it was national security" — a precursor case establishing that Warren's missile field had a documented UAP-reporting history even before the Atlas-to-Minuteman transition was complete.
1st Lieutenant, USAF; Deputy Missile Combat Crew Commander & Training Officer, F.E. Warren AFB
An ICBM launch officer stationed at F.E. Warren Air Force Base from January 1972, Billings later told researcher Robert Hastings of three separate incidents in 1973–74: a UFO hovering above the India launch facility while on duty at Golf LCC in fall 1973 (triggering the site's Outer and Inner Security Zone alarms, with roughly nineteen other launch control crews reportedly overhearing the related UHF radio traffic), a second sighting witnessed by an entire missile maintenance crew later that same fall, and a reported landing near Charlie LCC in early spring 1974 after which a staff sergeant witness faced disciplinary scrutiny for discussing it. These incidents, roughly a decade after the August 1965 wave, are cited by Hastings as evidence of a recurring pattern at the same missile field rather than an isolated event.
Captain, USAF (Ret.); Missile Combat Crew Commander, F.E. Warren AFB
A Minuteman missile combat crew commander at F.E. Warren Air Force Base in 1976, Fenstermacher reported that his flight's Security Alert Team observed a cigar-shaped object hovering low over his launch capsule before it moved rapidly from missile to missile across the flight; he says the team was ordered not to pursue it and his squadron's crews were later briefed never to discuss the incident. Fenstermacher went public with the account at Robert Hastings's National Press Club press conference on September 27, 2010 — the same event at which Robert Salas discussed the Malmstrom AFB shutdowns.
Comandante, Spanish Air Force; UFO Investigating Judge
Appointed by the Commanding General of the Canaries Air Zone to investigate the June 22, 1976 Gando Air Base / Canary Islands UFO sighting, Muñáiz Ferro-Sastre became the most prolific UFO-investigating judge in Spanish Air Force history, ultimately authoring four of its declassified case files — more than any other officer — nearly all centered on the 1974–1977 Canarian sighting cluster. He personally inspected a rumored burned field near Gáldar (finding an ordinary cultivated onion field), requested unsuccessfully that Dr. Francisco Padrón León undergo hypnotic regression, and later described his own method as demanding total objectivity, distinguishing himself from researchers who "only seek data favoring their ideas." His 1981 promotion monograph, "Método para la investigación de fenómenos aeroespaciales," documented the investigative methodology he developed across four Canarian case files.
General de División (Major General); Commanding General, Canaries Air Zone
As commanding general of the Canaries Air Zone, Dolz Espejo appointed the investigating officer for the June 22, 1976 Gando Air Base / Canary Islands UFO sighting — and then personally witnessed a near-identical recurrence himself on November 19, 1976, from the cockpit of a Spanish Air Force C-212 Aviocar (T-12) returning from Lanzarote. He described a luminous disc that rapidly expanded into a semicircular halo with a bright, bottle-green, barrel-shaped geometric core. His own written note in the resulting file speculated — without any access to classified foreign military data — that the phenomena were likely "experiments of certain powers," a guess later vindicated by the 2001 Poseidon missile identification.
BS
fl. 1978 – 2000
Director, "Setka-MO"; Soviet Ministry of Defense Anomalous Phenomena Program
Directed the Ministry of Defense's decade-long (1978–1988) classified UFO investigation program, a parallel military counterpart to Yuli Platov's Academy of Sciences program, providing the institutional backdrop against which the Kapustin Yar UAP Sighting was classified rather than publicized. Sokolov separately sold a different, privately-held document collection to American journalist George Knapp and ABC News in 1993–94, giving sensational on-camera accounts (including of the unrelated Usovo missile-base incident) that he substantially contradicted six years later in a sober 2000 co-authored retrospective with Platov in the Bulletin of the Russian Academy of Sciences, finding over 90% of roughly 3,000 Setka-era cases explainable by mundane aerospace activity.
VB
1937 – 2022
Last Chairman, KGB (1991)
Appointed to lead and dismantle the KGB following the failed August 1991 coup, Bakatin oversaw the security service's new posture of cooperation with declassification requests during the USSR's final months — the direct institutional context in which deputy chairman N.A. Sham transmitted the 124-page "Blue Folder" of anomalous-phenomena files, including the Kapustin Yar UAP Sighting, to cosmonaut Pavel Popovich on October 24, 1991.
JF
1890 – 1964
Minister for the Navy, Commonwealth of Australia (1954–1955)
A long-serving Queensland member of the Australian Parliament for Moreton (1922–1955) and twice Minister for the Navy, Francis's December 1954 official visit to HMAS Albatross, Nowra is what led directly to the public leak of the Hawker Sea Fury Sighting, after accompanying journalists overheard talk of the four-month-old classified radar-visual report. Rather than deny the resulting press coverage, Francis publicly confirmed its essential facts on December 16, 1954, without naming the pilot involved.
Constable, Royal Canadian Mounted Police, Langenburg Detachment
A 27-year-old RCMP constable in his first year posted to the Langenburg detachment, Morier took the initial call reporting Edwin Fuhr's sighting and personally examined the five ground impressions the following day, filing the RCMP incident report describing "five different distinct circles, caused by something exerting what had to be heavy air or exhaust pressure over the highgrass." He found no evidence of hoaxing and stated flatly that "whatever was in there, it came out of the air and departed the same way, as far as I could tell." Colleagues later in his career nicknamed him "Mulder," after the fictional FBI agent, on account of the case.
Head, Planetary Sciences Section, National Research Council of Canada
The NRC's senior in-house UFO analyst through the late 1970s, after Canada's Department of National Defence transferred civilian UFO-report handling to the NRC. In an undated internal position paper, "UFO's: What Are They?", McNamara argued that ground-trace evidence popularly attributed to UFO landings was routinely explainable by ordinary causes, including, in his own words, "the action of the fairy-ring mushroom" for reported rings of flattened or burnt grass — the same general category of naturalistic explanation this site's Langenburg UFO / Saucer Nests case file evaluates directly against the 1974 RCMP-documented circles, though no document located in this research shows McNamara addressing the Langenburg case by name specifically.
HT
fl. 1950s – 1970s
Nuclear/Defence Physicist; Head, Nuclear Branch, Joint Intelligence Bureau (by 1971)
O.H. ("Harry") Turner worked as a health physics officer on the British nuclear test program in Australia (including Maralinga) through the 1950s before moving into Australia's defence intelligence community, eventually heading the Nuclear Branch of the Joint Intelligence Bureau (later the Joint Intelligence Organisation) by 1971. In that capacity he reviewed the Royal Australian Air Force's own historical UFO files — including the Woomera radar case of 5 May 1954 at the center of this site's Woomera Rocket Range Sighting — in an internal 1971 report that researcher Bill Chalker later described as an unusually candid assessment by a senior government scientist. Chalker interviewed Turner directly in 1982, after Turner opened his personal UFO files to him, forming much of the documentary basis for Chalker's own subsequent writing on Australian government UFO investigations.
DR
Active 2019
Acting Security Section Chief, Palo Verde Nuclear Generating Station
The security official who, shortly before 11:00 p.m. on September 29, 2019, called the NRC's Headquarters Operations Center to report a swarm of five to six large drones surveying the restricted airspace around Palo Verde's Unit 3 reactor for the Palo Verde Nuclear Station Drone Swarm. Her report is the foundational record from which the entire subsequent federal incident file, and its eventual 2020 release under FOIA, descends.
IG
Active 2019
Security Supervisor, Palo Verde Nuclear Generating Station
Reported the second night (September 30, 2019) of the Palo Verde Nuclear Station Drone Swarm, including the detail that four drones appeared to launch from behind a mountain range east of the plant — testimony that directly enabled a Maricopa County Sheriff's Office search of that location, which found no operator.
TK
Active 2019
Headquarters Emergency Response Officer (HERO), U.S. Nuclear Regulatory Commission
Took Daphne Rodriguez's initial call on the night of September 29, 2019 and created the first Security Information Database entry documenting the Palo Verde Nuclear Station Drone Swarm — the internal federal record that, once released under FOIA in 2020, became the primary documentary source for the case's entire public timeline.
DN
Active 2019
Headquarters Emergency Response Officer (HERO), U.S. Nuclear Regulatory Commission
On overnight duty during the second night (September 30, 2019) of the Palo Verde Nuclear Station Drone Swarm, logged the second Security Information Database entry documenting that night's drone activity and the unsuccessful Maricopa County Sheriff's Office search for an operator.
ML
Active 2019
Deputy Director, Office of Nuclear Security and Incident Response, U.S. Nuclear Regulatory Commission
Authored the internal October 4, 2019 email describing the week of the Palo Verde Nuclear Station Drone Swarm as "Drone-a-palooza" — a phrase that later became the case's best-known shorthand once the underlying FOIA documents were published in 2020.
LP
Active 2019
Chief, Intelligence Liaison and Threat Assessment Branch (ILTAB), U.S. Nuclear Regulatory Commission
Objected internally to overnight duty-officer calls about the recurring Palo Verde Nuclear Station Drone Swarm, writing that her staff had been woken at 2 a.m. for updates "ILTAB can't really do anything about anyway" — an exchange that led directly to a new internal policy suspending overnight ILTAB notifications specifically for Palo Verde drone flyovers.
JR
Active 2019
Senior Level Advisor on Security, U.S. Nuclear Regulatory Commission
Observed internally, in records later released about the Palo Verde Nuclear Station Drone Swarm, that "restricted airspace will do nothing to stop an adversarial attack" — a candid acknowledgment that the plant's legal no-fly designation provided no physical deterrent against a determined drone operator.
RO
ATIC Equipment Specialist, Project Blue Book
Accompanied Edward Ruppelt on both 1952 Florida trips investigating the Sonny DesVergers Scoutmaster Case, operating the borrowed Geiger counter during the on-site search and participating in the second trip's background interviews and night-time reenactment.
Commander, Chilean Antarctic Base "Arturo Prat"
The Chilean Air Force officer who compiled and relayed the radio reports from the British, Chilean, and Argentine Antarctic bases into the Air Force's official July 7, 1965 communiqué on the Deception Island Sightings, specifically noting that pre-existing radio interference between the bases ruled out the reports having been coordinated or echoed from base to base.
WS
6th U.S. Naval Governor of Guam (1903–1904)
An 1871 U.S. Naval Academy graduate who fought at the Battle of Santiago de Cuba during the Spanish–American War and later directed the Mare Island Observatory's Pacific Fleet chronometer service, Sewell became the 6th Naval Governor of Guam in February 1903, pushing through reforms including legalized licensed alcohol sale, a revised tax and criminal code, a court system that lasted into the 1930s, and Guam's first telegraph cable. Briefly relieved by Lt. Frank H. Schofield in January 1904, Sewell resumed office and almost immediately fell gravely ill with an intestinal disorder. USS Supply raced him toward San Francisco for treatment — the same voyage during which the USS Supply Aerial Phenomenon was sighted, two days before landfall. Sewell died at the Mare Island Naval Hospital in mid-March 1904, still in office. His daughters, Helen Sewell and Marjorie Sewell Cautley, became a noted children's book illustrator and landscape architect respectively.
🔬

Scientists & Academics

150
AC
Active since 2001
Planetary Scientist, Armagh Observatory and Planetarium
A planetary scientist who has worked at the Armagh Observatory and Planetarium in Northern Ireland for more than two decades, studying near-Earth asteroids, comets, and interplanetary dust; co-discoverer, with colleague David Asher, of the Earth-companion asteroid 2010 SO16. Following the November 2018 Irish airspace UFO sightings, Christou told the BBC the pilots had most likely observed dust or rock entering the atmosphere at high speed — "commonly called shooting stars" — and estimated the fragment could have been as small as a walnut or an apple.
Sir Bernard Lovell Chair of Astrophysics & Director, Jodrell Bank Centre for Astrophysics, University of Manchester
A radio astronomer and Fellow of the Royal Society who has directed the Jodrell Bank Centre for Astrophysics since 2016 and chairs the International Academy of Astronautics' SETI Permanent Committee. Commenting on the November 2018 Irish airspace UFO sightings, Garrett told the Irish Examiner that a meteorite breaking apart high in the atmosphere "would also be travelling at speed and it would break into multiple components," calling it "a more reasonable explanation" than an unidentified craft while stressing the pilots' reports deserved to be taken seriously.
CM
1897 – 1989
Psychoanalyst; Founding Figure of the Italian Psychoanalytic Movement
Italy's most authoritative postwar psychoanalyst, Musatti personally observed a televised regressive-hypnosis session of Pier Fortunato Zanfretta and concluded the witness was acting "in buona fede" (in good faith), while candidly acknowledging the difficulty of separating "objective reality from subjective reality" in what he had observed — an assessment of sincerity, not of the literal truth of an extraterrestrial encounter.
Physician, Psychosomatic Medicine; Clinical Hypnotist
Conducted Pier Fortunato Zanfretta's regressive-hypnosis sessions beginning December 23, 1978, under which the "Dargos" entity narrative was first elaborated. Citing the depth of Zanfretta's trance state, Moretti concluded "the possibility that he lied is negligible" — a judgment about sincerity that later critics noted does not establish the accuracy of hypnotically recovered content, particularly given the sessions' documented lack of standard anti-suggestion safeguards.
Neurologist
Examined Pier Fortunato Zanfretta on January 31, 1979 and certified him in "perfect psychic and neurological condition," with no thought disorder or perceptual disturbance, clearing him for continued armed security duty — a finding that weighs against a simple psychiatric-illness explanation for his reports without independently verifying their content.
Professor; Director, International Center for Medical and Psychological Hypnosis, Milan
Administered a sodium-pentothal ("truth serum") session to Pier Fortunato Zanfretta in Milan, under which Zanfretta repeated his hypnotically-derived account without material variation. Marchesan himself cautioned that such statements, however sincerely given, "potrebbero comunque non corrispondere alla realtà" (might nonetheless not correspond to reality).
Clinical Psychologist
Conducted the March 16, 1988 hypnotic regression session with the anonymous witness at the center of the Ilkley Moor Incident, under which the witness's original sighting expanded into a full abduction narrative including paralysis, levitation, and a medical-style examination. Singleton's own clinical conclusion — that the witness was "telling the truth as he knew it" — is a careful statement about sincerity rather than external accuracy, mirroring the same hedge offered by hypnotists in other cataloged hypnotic-regression cases such as Marco Marchesan's sodium-pentothal session with Pier Fortunato Zanfretta.
PB
1867 – 1942
Physics & Astronomy Professor, Denison University
Denison University professor who mentored a young T. Townsend Brown in 1924–25, giving his name to the "Biefeld-Brown effect." Genuinely worked alongside Brown on unrelated eclipse photography, but Denison's own archives contain no joint scientific publication on the capacitor-thrust effect, and Biefeld's son later stated no real scientific collaboration occurred.
Physicist, Office of Naval Research
The ONR physicist assigned in 1952 to evaluate T. Townsend Brown's Project Winterhaven electrogravitics claims. His September 15, 1952 report (ONR File #24-185) concluded the observed thrust was ordinary "electric wind" — a finding that decades of later vacuum-chamber physics would independently confirm.
Aerospace Physicist
Author of the 2004 AIAA Journal paper "Biefeld-Brown Effect: Misinterpretation of Corona Wind Phenomena," the most rigorous modern test of T. Townsend Brown's electrogravitics claims. By enclosing test electrodes in a sealed housing that physically excluded corona wind, Tajmar's experiment found no residual thrust at all, strongly confirming ion wind as the complete explanation.
ET
1908 – 2003
Theoretical Physicist, Los Alamos Scientific Laboratory; "Father of the Hydrogen Bomb"
A Manhattan Project veteran and the chief scientific architect of the U.S. thermonuclear weapons program, Teller attended the classified February 16, 1949 Los Alamos conference convened to evaluate the Green Fireballs wave, personally pressing meteor astronomer Lincoln La Paz for specifics on his December 12, 1948 sighting rather than dismissing it outright. The declassified 2026 conference transcript documents his direct questioning of La Paz's intensity and duration data.
JK
1902 – 1991
Professor of Physics, UCLA; Upper-Atmosphere & Aeronomy Authority
A Hungarian-born physicist and pioneer of the science of aeronomy, chairman of UCLA's physics department (1938–44) and a leading authority on the chemistry and physics of the stratosphere. Kaplan attended the February 16, 1949 Los Alamos conference on the Green Fireballs, then went on to personally co-initiate Project Twinkle, the Air Force's 1950–51 camera-based effort to photograph the phenomenon. He later chaired the U.S. National Committee for the International Geophysical Year and advised Presidents Eisenhower and Nixon on aerospace matters.
NB
1909 – 1997
Director, Los Alamos Scientific Laboratory (1945–1970)
J. Robert Oppenheimer's handpicked successor as director of Los Alamos National Laboratory, a post Bradbury held for twenty-five years. He personally hosted the classified February 16, 1949 conference inside his own laboratory to evaluate the Green Fireballs wave, lending the case the full institutional weight of the nation's primary nuclear-weapons design laboratory.
FR
1918 – 1998
Group Leader, Theoretical Division, Los Alamos Scientific Laboratory; 1995 Nobel Laureate in Physics
A Los Alamos physicist since 1944, recruited into the Theoretical Division under Richard Feynman, Reines attended the February 16, 1949 Los Alamos conference on the Green Fireballs years before his career-defining 1956 discovery of the neutrino alongside Clyde Cowan — work that earned him the 1995 Nobel Prize in Physics. His presence at the conference underscores how far up the Laboratory's own scientific hierarchy the green fireball question reached.
DM
1901 – 1976
Astrophysicist & Director, Harvard College Observatory
The most prominent public advocate of the temperature-inversion and optical-mirage explanation for the 1952 Washington sightings, popularized in Life magazine's April 1952 feature "Have We Visitors From Space?" and laid out at length in his 1953 book Flying Saucers — supplying the explanatory template the Air Force adopted at its July 29, 1952 press conference. Decades later, revealed to have simultaneously held a Top Secret Ultra clearance and worked as a classified NSA/DIA cryptologic consultant for over thirty years — a dual role that continues to complicate assessments of his public skepticism. He separately corresponded for years with pilot William B. Nash, ultimately proposing an optical-refraction explanation for the July 1952 Nash-Fortenberry sighting in his 1963 book The World of Flying Saucers — the same book, co-authored with Lyle Boyd, in which he first published the shadow-direction inconsistency that would eventually unravel the 1952 Barra da Tijuca photographs.
BM
Active since 1970s
Optical Physicist, U.S. Navy
Longtime UFO researcher who has published detailed technical defenses of the 1952 Washington radar data against the official temperature-inversion explanation, including a widely cited 50th-anniversary reassessment in 2002 arguing the Air Force's own later mirage studies undercut its original conclusion. Conducted the most extensive densitometric re-analysis of the 1950 McMinnville Trent photographs (1975–1981), concluding the case was not a hoax. Also travelled to New Zealand and Melbourne to interview witnesses after analyzing cameraman David Crockett's film of the December 1978 Kaikōura sightings, publishing his findings in a 1979 Applied Optics paper that concluded the filmed object was difficult to reconcile with known conventional explanations. Wrote a ninety-page technical defense of Ed Walters's Gulf Breeze Polaroids beginning in 1988, but his own distance recalculation for one disputed frame later shifted from 185 feet to 370 feet after MUFON's internal reinvestigation challenged his original figures.
GN
b. ~1961
Professor of Pathology, Stanford University
One of the most published scientists in the world (600+ papers). Has analyzed alleged UAP crash debris using atomic probe tomography and isotopic analysis. Conducted MRI studies of UAP experiencers, finding unusual brain structures. Co-founded the SOL Foundation. Was approached by the CIA to analyze materials. Connected to Tim Taylor, Diana Pasulka, and a New Mexico crash site expedition.
SOL Foundation Metamaterials Tim Taylor Diana Pasulka Roswell Ubatuba Magnesium Fragments
HP
Physicist; co-founder of SRI remote viewing program
Former NSA employee who co-directed the CIA-funded remote viewing program at SRI International (1972–1985). Served as advisor to AATIP/AAWSAP. Co-founded TTSA with Tom DeLonge. Bridges remote viewing, UAP physics, and zero-point energy research. Has explored "ultraterrestrial" hypotheses — suggesting UAP may involve extradimensional beings or ancient breakaway civilizations. As Director of EarthTech International, formulated the Polarizable Vacuum (PV) model, an attempt to explain UAP flight characteristics through localized metric shifts in the vacuum.
SRI International Russell Targ AATIP TTSA Lue Elizondo Vacuum Polarizability Metamaterials
ED
Active since 1990s
Physicist; Senior Science Advisor, EarthTech International
A physicist who has worked closely with Hal Puthoff at EarthTech International, was hired as full-time staff at the National Institute for Discovery Science (NIDS) and later contracted to Bigelow Aerospace Advanced Space Studies (BAASS), working on the AAWSAP and AATIP programs and investigating land around the actual Skinwalker Ranch in Utah. Has argued a subset of UAP cases demonstrates technology inconsistent with known aeronautics. No documented connection to Chris Bledsoe's case has been identified.
Hal Puthoff AAWSAP Skinwalker Ranch
SR
Active since 2000s
Associate Professor of Mechanical & Aerospace Engineering, University of Florida
Aerospace engineer whose U.S. Air Force-funded plasma-actuator research culminated in a 2008 patent application for the "Wingless Electromagnetic Air Vehicle" (WEAV), a battery-powered, saucer-shaped craft under six inches across with no moving parts, generating lift and thrust entirely through magnetohydrodynamic manipulation of ionized air at its surface. Both the U.S. Air Force and NASA expressed interest in the concept, and the University of Florida sought to license the design, though no prototype has achieved sustained atmospheric flight.
Plasma Actuators Magnetohydrodynamics U.S. Air Force Funding
LM
Active 1976–2000s
Aerospace Engineer, Rensselaer Polytechnic Institute
Developer of the laser-driven "lightcraft" concept, in which a ground-based pulsed laser ionizes air beneath the vehicle into propulsive plasma. Funded successively by the Strategic Defense Initiative, NASA's Marshall Space Flight Center, and the U.S. Air Force Research Laboratory, Myrabo's prototypes achieved flight-tested altitudes of over 200 feet at White Sands Missile Range's High Energy Laser Systems Test Facility, setting a Guinness World Record for a laser-propelled vehicle on October 2, 2000.
Lightcraft Beamed-Energy Propulsion AFRL
BH
Astrophysicist, Solar & Astrophysics Laboratory, Lockheed Martin
German-born astrophysicist with a Ph.D. from the University of Wisconsin–Madison who spent a decade as an editor of the Astrophysical Journal and developed the quantum vacuum inertia hypothesis with Alfonso Rueda while at Lockheed Martin's Solar & Astrophysics Laboratory. Co-inventor, with Garret Moddel, of U.S. Patent 7,379,286, "Quantum Vacuum Energy Extraction," granted in 2008, proposing a method to extract usable energy by cycling atoms through Casimir cavities.
Garret Moddel Zero-Point Energy US Patent 7,379,286
GM
Active since 1990s
Professor, Electrical, Computer & Energy Engineering, University of Colorado Boulder
Co-inventor, with Bernard Haisch, of U.S. Patent 7,379,286, "Quantum Vacuum Energy Extraction" (granted 2008), and lead author of a 2012 experimental test of the underlying "pumping atoms through Casimir cavities" mechanism. In a 2019 self-assessment published in Atoms with Olga Dmitriyeva, Moddel concluded that two rival classes of proposed zero-point energy extraction violate basic thermodynamic principles, while his own patented approach does not appear to, though its own 2012 experimental results were "tantalizing but inconclusive."
Bernard Haisch Casimir Cavities University of Colorado Boulder
IS
Physicist, Harvard University
Harvard professor of physics who, with then-postdoctoral fellow Ranga Dias, published a January 2017 paper in Science reporting the creation of solid metallic hydrogen inside a diamond anvil cell at a claimed pressure of 495 gigapascals and 5.5 kelvin, decades after Eugene Wigner and Hillard Bell Huntington first predicted the phase in 1935. The single sample was lost when the diamonds fractured during a planned pressure-release step before it could be sent to Argonne National Laboratory for independent verification, and high-pressure physicist Paul Loubeyre has publicly disputed that the claimed pressure was achievable at all in the apparatus used.
Ranga Dias Metallic Hydrogen Harvard University
RD
Active since 2010s
Physicist, University of Rochester
Co-author, as a Harvard postdoctoral fellow, of the disputed 2017 metallic hydrogen claim with Isaac Silvera. Later, as a University of Rochester professor, led two further high-profile "room-temperature superconductor" claims — a 2020 carbonaceous sulfur hydride paper and a 2023 nitrogen-doped lutetium hydride paper, both in Nature — that were subsequently retracted in 2022 and 2023 respectively after a University of Rochester research-misconduct investigation, commissioned at the request of the National Science Foundation, found data fabrication, falsification, and plagiarism. Dias has denied wrongdoing.
Isaac Silvera Retracted Papers University of Rochester
AZ
Physicist, University of Vienna
Austrian physicist whose research group first experimentally demonstrated quantum teleportation — transferring a photon's quantum state onto a second, distant photon — in 1997, and who spent decades conducting increasingly rigorous, loophole-closing tests of Bell's inequality. Jointly awarded the 2022 Nobel Prize in Physics with John Clauser and Alain Aspect "for experiments with entangled photons, establishing the violation of Bell inequalities and pioneering quantum information science." Has never proposed or endorsed any UAP propulsion application of entanglement; the no-communication theorem his own field's mainstream physics relies on directly rules out using entanglement to transmit energy or information faster than light.
2022 Nobel Prize Quantum Teleportation Bell Inequality
LS
Physicist, Stanford University
Theoretical physicist and a founding figure of string theory and the holographic principle who, with Juan Maldacena, proposed the ER=EPR conjecture in a 2013 paper, suggesting that pairs of maximally entangled particles are connected by a microscopic, non-traversable wormhole (an Einstein-Rosen bridge). The conjecture is genuine, actively researched theoretical physics addressing the relationship between quantum entanglement and spacetime geometry — it implies nothing about macroscopic transportation or propulsion, and Susskind has never applied it to any UAP-related claim.
ER=EPR Conjecture Holographic Principle Stanford University
Materials Scientist, Tampere University of Technology, Finland
Russian-born ceramics engineer who, while researching superconductor manufacturing at Tampere University of Technology, reported in a 1992 Physica C paper that a rotating, magnetically levitated superconducting disc appeared to reduce the weight of objects placed above it by roughly 0.3%, a claimed "gravity shielding" effect. NASA's Marshall Space Flight Center and the University of Alabama in Huntsville attempted replications between 1997 and 2002; the most careful of these, led by Gregory Hathaway, detected no weight modification down to the 0.001% level. Podkletnov has continued independently reporting further experiments, including a claimed "gravity beam" device, none independently replicated.
Gravity Shielding Physica C (1992) Tampere University
RT
Physicist, laser pioneer; co-director of SRI remote viewing program
Partnered with Hal Puthoff at SRI International to develop the government's remote viewing program (Project Stargate), running for over 20 years funded by CIA and DIA. Subject of the documentary Third Eye Spies (2019). Demonstrated statistically significant evidence for remote viewing under controlled conditions. His work connects consciousness research to the broader UAP phenomenon.
SRI International Hal Puthoff Project Stargate CIA
DP
Professor of Religious Studies, UNC Wilmington
Author of American Cosmic (2019) and Encounters (2023), examining how UFO belief functions as a new form of religion. Was taken to a crash site in New Mexico by Tim Taylor ("Tyler D.") alongside Garry Nolan. Documents how Silicon Valley technologists and government insiders interact with the phenomenon. Her academic lens on cultural and religious dimensions is unique.
AL
b. 1962
Frank B. Baird Jr. Professor of Science, Harvard University
Proposed that 'Oumuamua could be an alien light sail. Founded the Galileo Project for systematic scientific search for ET technological artifacts. Led ocean expeditions to recover fragments of IM1, an interstellar meteor. Represents the most mainstream academic effort to apply scientific rigor to the search for ET artifacts, shifting SETI from signals to physical technosignatures.
Galileo Project 'Oumuamua Harvard
MK
Theoretical physicist, City College of New York
Co-founder of string field theory. Has increasingly shifted toward taking UAP seriously, stating in 2021 that the "burden of proof has shifted" from believers to skeptics. Argues that any genuine ET craft would represent civilizations millions of years more advanced, operating with physics unknown to us. Has called for formal scientific committees to investigate UAP.
String Theory Science Communication
MB
fl. 1970s–2000s
Biologist, Institut National de la Recherche Agronomique (INRA)
French INRA biologist whose doctoral research examined plant trauma responses to radiation exposure. Conducted the central biochemical analysis of the Trans-en-Provence case, documenting a distance-correlated reduction in chlorophyll and carotenoid pigments (including beta-carotene and violaxanthin) in wild alfalfa collected near the 1981 ground trace. Later applied a similar "traumatic factor" interpretive framework to the unrelated 1997 Nort-sur-Erdre case, which subsequently turned out to be a hoax perpetrated by children — a fact skeptical researchers have since cited as grounds for broader caution about his biochemical methodology.
AH
1910 – 1986
Astronomer, Northwestern University; Project Blue Book consultant
Scientific consultant to Project Blue Book (1952–1969), initially a skeptic who became convinced the phenomenon was genuine. Created the Close Encounter classification system (CE1–CE3). Founded CUFOS (Center for UFO Studies). His transformation from debunker to advocate is one of the most significant arcs in UFO history. Coined "swamp gas" at a March 25, 1966 Detroit press conference following the Michigan “Swamp Gas” UFO Wave — a hedged, partial explanation the press reduced to a punchline he later deeply regretted, telling Omni in 1985: "I was a thorough skeptic, and I'm afraid I helped to engender the idea that it must be nonsense, therefore it is nonsense."
BV
Astronomer, Nordita (Nordic Institute for Theoretical Physics)
Leads the ~40-member VASCO (Vanishing & Appearing Sources during a Century of Observations) project, systematically comparing 1950s sky survey plates with modern data to identify objects that have appeared or vanished. Found statistically significant correlations between 1950s transients and both nuclear weapons tests (68% more likely post-test) and UAP reports. Co-authored a 2024 MNRAS paper on a "bright triple transient" recorded on Palomar Observatory plates dated July 19, 1952 — the same calendar date as the first night of the Washington radar-visual flap — and a follow-up study flagging a second candidate anomaly on July 27, 1952, coinciding with the flap's second weekend. She is careful to describe these as statistical coincidences worth investigating, not evidence connecting the two phenomena.
Astronomer; VASCO Project Collaborator
Lead author, with Beatriz Villarroel as co-author, of the 2024 Monthly Notices of the Royal Astronomical Society paper "A bright triple transient that vanished within 50 min," documenting three point sources on Palomar Observatory sky-survey plates from July 19, 1952 that dimmed by more than ten magnitudes within under an hour and have never reappeared in 70+ years of follow-up imaging.
Professor of Anesthesiology & Pain Researcher, Vanderbilt University Medical Center; VASCO Collaborator
A credentialed medical-research scientist who began an independent, "nights and weekends" collaboration with Beatriz Villarroel after meeting at a May 2024 conference. Co-authored both of VASCO's October 2025 papers — the nuclear-test/UAP-report correlation study in Scientific Reports and the aligned multiple-transient events study in Publications of the Astronomical Society of the Pacific — and continued the collaboration into a 2026 response to a published critique of that work.
Exoplanet Astronomer; VASCO Co-Author
A prominent exoplanet-discovery pioneer who retired from UC Berkeley in 2015 after a university investigation substantiated sexual harassment complaints, and was expelled from the National Academy of Sciences in 2021. Marcy has co-authored several VASCO papers with Beatriz Villarroel since 2021, including the 2021 nine-transients Scientific Reports study and a 2025 response to a leading plate-artifact critique; his continued collaboration with Villarroel became the direct source of a "guilt by association" professional controversy she has described in detail in her own public writing.
NH
Astronomer, University of Edinburgh; Leading Scientific Critic of VASCO
A specialist in SuperCOSMOS photographic-plate digitization technology whose February 2024 paper with co-author A. Blair in RAS Techniques and Instruments is the most detailed published critique of Beatriz Villarroel's VASCO transient claims, arguing many of the reported sources are photographic-emulsion artifacts rather than genuine astrophysical flashes. Recommended direct microscopic examination of the original glass plates as the most decisive remaining test.
CM
1920 – 2010
Project Mogul scientist, atmospheric physicist
Principal scientist on Project Mogul, the classified balloon program the Air Force identified as the Roswell debris source. Reconstructed a trajectory for Flight #4 that could place debris on the Foster Ranch. His trajectory reconstruction relies on disputed wind data assumptions.
Roswell Project Mogul Flight 4
BS
1904 – 1980
Psychiatrist and neurologist, Boston
Utilized regressive hypnosis in 1964 to treat Betty and Barney Hill for trauma and amnesia following their 1961 UAP encounter. Simon concluded they were completely honest in their beliefs, but that the abduction was a shared psychological construct originating from Betty's nightmares.
Betty & Barney Hill Hypnosis
MF
1932 – 2013
Schoolteacher and amateur astronomer
Spent several years starting in 1966 analyzing the star map drawn by Betty Hill under hypnosis. Built 3D stellar models and concluded the map depicted the double star system Zeta Reticuli as the abductors' home. Her work was published in Astronomy magazine in 1974 and debated by Carl Sagan.
Betty & Barney Hill Zeta Reticuli
LS
1930 – 2021
Counseling psychologist, University of Wyoming
Condon Committee psychological consultant who conducted the February 13, 1968 hypnotic regression of Herbert Schirmer. Concluded Schirmer's "emotional reactions suggest that he believes in the reality of the events he describes" — a narrower finding than the Committee's own published verdict. Went on to conduct over 500 hypnotic regressions of contactees/abductees and founded the Rocky Mountain Conference on UFO Investigation in 1980.
JM
1929 – 2004
Professor of Psychiatry, Harvard Medical School; author
A Pulitzer Prize-winning biographer (1977) who pioneered the clinical study of UAP abductees, culminating in his landmark 1994 investigation of the Ariel School mass landing in Zimbabwe. Mack concluded the children were telling the truth, ruling out mass hysteria. His work triggered a 14-month peer-review inquiry at Harvard that ended with the full protection of his tenure and academic freedom. Struck and killed by a drunk driver in London.
AM
Physicist, UCLouvain; SOBEPS Scientific Adviser
Professor of Physics at the Catholic University of Louvain (UCLouvain) and scientific adviser to SOBEPS during the Belgian UFO Wave. Meessen was among the first physicists to systematically analyze the F-16 radar recordings from the March 30–31, 1990 intercept. His 1994 paper proposed that the extreme radar lock readings — showing targets at 30G to 40G acceleration — might be software artifacts caused by anomalous propagation: the bending of radar beams through atmospheric thermal stratification layers. This "AP" explanation became the primary scientific counter-argument to the anomalous interpretation. A nuanced scientist, Meessen never closed the door on genuinely anomalous explanations. He continued publishing on UAP-related physics into his final years and died in 2023, aged 97.
belgian-wavescientistsacademicsphysicsradarUCLouvainSOBEPSskepticalanalysis
CJ
1875 – 1961
Psychiatrist & Founder of Analytical Psychology
Authored "Flying Saucers: A Modern Myth of Things Seen in the Skies" (1958), exploring UAP sightings as meaningful psychological projections of Jungian archetypes in response to Cold War anxiety.
Psycho-Social Archetypes
MM
Active since 2019
Professor of Biological Anthropology
Author of "Identified Flying Objects", proposing the Chrononaut Hypothesis—that UAP pilots are future human descendants traveling backward in time to study their own evolutionary past.
Time Traveler Evolution
JB
Active since 1973
Harvard Astrophysicist
Formulated the Zoo Hypothesis in 1973, suggesting that advanced extraterrestrial civilizations observe Earth covertly under a strict non-interference policy, resolving the Fermi Paradox.
Zoo Hypothesis Fermi Paradox
MA
Active since 1994
Theoretical Physicist
Formulated the Alcubierre Metric in 1994, a mathematical solution to Einstein's field equations that allows a warp bubble to compress space-time in front of a craft and expand it behind, enabling apparent faster-than-light travel.
Warp Drive General Relativity
LD
1922 – 2011
Chemical Engineer & Nuclear Physicist
One of the first researchers to propose that UAPs were advanced domestic military craft, and that reports of alien visitations were deliberate psychological warfare campaigns orchestrated by the CIA to cover up classified radar and aerospace tests. Also cross-checked Nicholas Roerich's own published diary against an earlier, widely repeated secondhand summary, correcting the Roerich Expedition Sighting's date from 1926 to its actual August 5, 1927, and first proposed a stray Sven Hedin expedition weather balloon as a possible explanation.
Government Deception Disinformation Roerich Expedition Sighting
NB
Active since 2003
Philosopher & Futurist
Formulated the Simulation Argument in 2003, arguing that it is statistically highly probable that we live in a simulated reality, providing the theoretical basis for UAPs as rendering glitches or administrative interventions.
Simulation Philosophy
RV
Active since 2019
Computer Scientist & Game Designer
Author of "The Simulation Hypothesis", exploring UAP physical behavior (e.g., instant velocity shifts, teleportation) as typical rendering updates in a multiplayer virtual environment.
Simulation Virtual Physics
MP
Cognitive Neuroscientist
Developed Tectonic Strain Theory (TST), proposing UAPs are glowing piezoelectric energy balls generated by crustal stresses, which emit magnetic fields that stimulate human temporal lobes to induce paranormal hallucinations.
Tectonic Strain Neurology
ES
Active since 1983
Electrical Engineer & Associate Professor, Østfold University College
Took technical and scientific responsibility for Project Hessdalen's founding 1984 field investigation and has led or co-led the project continuously since, becoming its formal project manager from 1993 onward. Authored the project's first Final Technical Report in January 1985 and has personally observed and helped instrument dozens of recorded light events across four decades of continuous fieldwork in Norway's Hessdalen valley.
MT
Active since 2000
Italian Astrophysicist
Led much of the optical spectroscopy and photometric analysis during the international EMBLA missions to Hessdalen (2000–2002), personally recording and interpreting live spectra of observed events in the field. Published the case's most comprehensive single scientific survey, "A Long-Term Scientific Survey of the Hessdalen Phenomenon" (Journal of Scientific Exploration, 2004), and proposed its most widely cited piezoelectric light-generation mechanism.
BH
Active since 2000
Engineering Academic, Østfold University College
Led the most extensive radar cross-section studies of the Hessdalen lights, recording tracked velocities up to roughly 8,500 m/s with no corresponding solid-mass radar return, published in Acta Astronautica (2010). Personally photographed and spectroscopically documented a light event on September 20, 2007, using a transmission-grating-equipped camera, later published through the European Geosciences Union's Imaggeo archive.
IS
Naturalist, Zoologist & Founder, Society for the Investigation of the Unexplained (SITU)
Scottish-born naturalist and popular science writer who founded SITU in 1967 to investigate UFOs, cryptids, and other anomalous phenomena. His 1972 Saga magazine article "The Twelve Devil's Graveyards Around the World" popularized the "anomaly zones" concept — a proposed worldwide grid of geographic clusters (including the Bermuda Triangle and the Devil's Sea) with elevated rates of unexplained disappearances and sightings, an idea later applied to water-proximity analysis of UAP reports. Summarized his broader case files in Investigating the Unexplained (1972).
PD
British Earth-Mysteries Writer & Researcher
Editor of the journal The Ley Hunter (1976–1996) who launched the instrumented Dragon Project at the Rollright Stones in 1977 and coined the term "Earth Lights" in his 1982 book of the same name, proposing that fault-line-associated luminosity — including the Hessdalen lights — constitutes a single worldwide geophysical phenomenon. Incorporated Dr. Michael Persinger's neuropsychological research into his 1989 follow-up, Earth Lights Revelation.
Earth Lights Hessdalen Lights
Astronomer, Condon Committee (University of Colorado UFO Project)
Planetary astronomer assigned as the Condon Committee's principal photographic-case investigator. His 1968 photogrammetric and photometric analysis of the McMinnville Trent photographs (Condon Report Case 46) concluded the images were "consistent with the assertion that an extraordinary flying object...flew within sight of two witnesses" while explicitly declining to rule out fabrication — one of only a handful of cases the Condon Report itself left formally unresolved. He also identified an unresolved lighting/shadow discrepancy in the photographs later expanded upon by skeptics. He reached a similarly cautious verdict on the Nick Mariana film (Case 47), concluding the aircraft explanation was "not possible" without proving the objects were spacecraft. Hartmann went on to a prominent career co-developing the giant-impact hypothesis for the Moon's origin. The Condon Report's Case 48 file, addressing the 1952 Barra da Tijuca photographs, came out of the same photographic-analysis unit Hartmann led, independently confirming Donald Menzel and Lyle Boyd's 1963 shadow-direction finding from enlarged prints of the negatives.
EF
fl. 1970s–2010s
Organic Chemist; Soil Analyst, Delphos, Kansas Case
British organic chemist, holder of a Ph.D. in the organic synthesis of carotenoid pigments and a career pharmaceutical development chemist, who obtained preserved soil samples from the Delphos, Kansas ring through the University of Nottingham. His 1989 paper in the Journal of UFO Studies, "The Delphos Case: Soil Analysis and Appraisal of a CE-2 Report," identified a water-soluble organic compound coating the ring soil that he judged difficult to explain as either a simple hoax or an ordinary fairy ring. His 2014 book with Michael D. Swords, The Compelling Scientific Evidence for UFOs, related his findings to the 1997 Sturrock Panel's broader review of UFO physical evidence.
Optical & Radar Physicist, Condon Committee
Authored the Condon Committee's official technical analyses of both the 1956 Lakenheath–Bentwaters radar-visual incident (Case 2 of the 1969 Condon Report) and the 1957 RB-47 bomber chase. Concluded the probability of "at least one genuine UFO" at Lakenheath was "fairly high," and called the Air Force's official RB-47 explanation "literally ridiculous."
HK
Active since 1970s
Examining Pediatrician
Pediatrician who, along with Dr. Joseph Saults, conducted the initial medical examination of Travis Walton upon his return. He documented severe dehydration, weight loss, and the small puncture mark in Walton's elbow, and later witnessed Harder's hypnosis sessions.
JH
1926 – 2006
APRO Research Director & Professor
Professor of civil engineering at the University of California, Berkeley, and research director for APRO. He conducted the regression hypnosis sessions with Travis Walton, concluding that his emotional responses and retrieved memories of the craft were genuine.
JM
1920 – 1971
Atmospheric Physicist
Senior physicist at the Institute of Atmospheric Physics and professor at the University of Arizona. He was one of the most prominent scientists in the 1960s to advocate for the extraterrestrial hypothesis, testifying before Congress in 1968 and criticizing the Condon Committee's methodology. He separately reviewed and rejected Donald Menzel's optical-refraction explanation for the 1952 Nash-Fortenberry sighting as an "almost entirely ad hoc assumption." From 1967 until his death in 1971 he conducted his own four-year investigation of Rex Heflin's 1965 UFO photographs alongside William Hartmann, ultimately calling them "the outstanding photographic evidence yet submitted concerning UFOs" even as his own unresolved doubts about one of the four frames caused some researchers to lose interest in the case.
ED
Active since 1990s
Astrophysicist & Defense Consultant
Astrophysicist who authored the classified Davis-Wilson memo (2002) detailing his meeting with Admiral Thomas Wilson regarding a deep black crash retrieval program. Former researcher for Bigelow Aerospace (BAASS) and EarthTech International, specializing in advanced propulsion physics.
EarthTech Bigelow Aerospace
CK
Active since 1990s
Biochemist & Research Director
Biochemist who served as the deputy administrator and research director for the National Institute for Discovery Science (NIDS) at Skinwalker Ranch. Co-authored Hunt for the Skinwalker with George Knapp, documenting paranormal and UAP activity at the ranch.
NIDS Skinwalker Ranch
CS
1911 – 1960
Astronomer, Vanderbilt University (namesake of "Seyfert galaxies")
Professionally trained astronomer who, on the afternoon of January 7, 1948, observed an object through a telescope from south of Nashville, Tennessee and identified it in explicit instrument terms as a pear-shaped balloon with cables and a suspended basket, drifting at roughly ten miles per hour near 25,000 feet. His account became a cornerstone of Edward Ruppelt's later Skyhook conclusion in the Mantell case.
WR
Professor of Geology, Texas Technological College
Hosted the original August 25, 1951 sighting of the Lubbock Lights in his own backyard alongside colleagues A.G. Oberg and W.L. Ducker. Edward Ruppelt considered the professors' team the most technically qualified witness group he encountered during his entire tenure at Project Blue Book.
AO
Professor of Chemical Engineering, Texas Technological College
One of the three founding witnesses of the August 25, 1951 Lubbock Lights sighting, observed from Dr. W.I. Robinson's backyard. Continued observing and attempting to instrument subsequent sightings with colleagues through the following weeks.
Head, Department of Petroleum Engineering, Texas Technological College
Senior member of the professors' team that first witnessed the Lubbock Lights on August 25, 1951. Defended the sighting publicly for years while privately researching the phenomenon; researchers examining Edward Ruppelt's revised 1960 book have identified Ducker as the "anonymous scientist" Ruppelt credited with finally solving the case, variously reported as concluding the lights were night-flying moths or birds reflecting Lubbock's new mercury-vapor street lighting. Gave a candid oral-history interview to Texas Tech's Southwest Collection in 1980, two years before his death.
GM
fl. 1951
Joined the expanded Lubbock Lights observing team for later 1951 sightings, including the September 5 flight he described as "about the size of a dinner plate," "absolutely circular," and productive of "an extremely eerie feeling." Gave the case's most detailed contemporaneous rejection of the plover explanation, arguing the objects were too large, too fast, and too silent to be any bird he knew of.
Physicist, Douglas Aircraft Corporation; later UCLA Astrodynamicist
A UCLA-trained physicist and engineer, Baker independently reanalyzed both of the U.S. government's strongest motion-picture UFO cases from the early 1950s. In 1955 he examined a duplicate of the Tremonton, Utah film, finding the objects' motion "not exactly what one would expect from a flock of soaring birds" while stopping short of confirming an anomalous origin. He spent roughly eighteen months in 1955–56 conducting a parallel photogrammetric analysis of Nick Mariana's film for Greene-Rouse Productions' United Artists documentary U.F.O., publishing his findings as "Photogrammetric Analysis of the 'Montana' Film Tracking Two UFOs" (Douglas Aircraft, March 1956). He concluded the official jet-reflection explanation for Mariana's footage was "quite strained," and reaffirmed in 1968 congressional testimony that after detailed study of both films "neither of these hypothesized natural phenomena explanations had merit." He went on to direct Lockheed's Astrodynamics Research Center and teach astronomy and engineering at UCLA.
RC
Active 1966 – 1968
Field Investigation Leader, Condon Committee, University of Colorado
A physical chemist who led the Condon Committee's field investigation teams, Craig reexamined the Mariana film as part of the University of Colorado's federally funded UFO study, flagging a discrepancy between the claimed August 15 sighting date and Great Falls' published home-game schedule. He was also approached at a June 1967 Boulder, Colorado conference by RB-47 pilot Lewis Chase, who had stayed silent about his 1957 encounter for a decade; Chase's unsolicited account to Craig prompted the Committee to open a formal file on that case. He later published his own account of the project, UFOs: An Insider's View of the Official Quest for Evidence (1995).
FF
1891 – 1971
Chief Chemist, Mineral Production Laboratory, Brazilian Ministry of Agriculture
An Austrian-born analytical chemist and internationally recognized pioneer of spot-test chemistry, Feigl fled the 1938 Anschluss and emigrated to Brazil, becoming head of the Ministry of Agriculture's Mineral Production Laboratory in 1941. In September 1957 he oversaw the first laboratory analyses of the Ubatuba magnesium fragments delivered by Olavo Fontes, initially rejecting a meteorite hypothesis before ordering the spectrographic tests that produced the case's founding "100% pure magnesium" finding.
PS
1924 – 2015
Professor of Applied Physics, Stanford University
A British-American physicist specializing in astrophysics, plasma physics, and solar physics who also pursued rigorous scientific study of UFO physical evidence, organizing a 1998 Rockefeller-funded scientific review panel and publishing The UFO Enigma: A New Review of the Physical Evidence (1999). In 1987, Sturrock took custody of the remaining Ubatuba magnesium samples from Coral Lorenzen, arranged new isotope testing, and published the definitive synthesis of the case's first 40 years of laboratory analysis in the Journal of Scientific Exploration in 2001.
DS
Active 1966 – 1968
Psychologist & Principal Investigator, Condon Committee
A University of Colorado psychologist who served as a principal investigator on the Condon Committee and built the pioneering UFOCAT computer database of sighting reports, Saunders was among the Committee members most convinced the Mariana film constituted strong evidence. He was dismissed from the project in 1968 after he and a colleague leaked an internal memo suggesting the study's conclusions had been decided in advance, later co-authoring UFOs? Yes! Where the Condon Committee Went Wrong (1969).
EC
1902 – 1974
Physicist, University of Colorado; Director, Scientific Study of Unidentified Flying Objects
A former director of the National Bureau of Standards and past president of the American Physical Society, co-namesake of the Franck–Condon principle in quantum chemistry, Condon was recruited in July 1966 to direct the Air Force-funded University of Colorado UFO Project after the USAF Scientific Advisory Board's O'Brien Committee recommended handing the subject to an independent university. He remained largely detached from the project's day-to-day fieldwork, leaving operational control to coordinator Robert J. Low, and authored the report's final "Conclusions and Recommendations," stating flatly that "nothing has come from the study of UFOs in the past 21 years that has added to scientific knowledge" — a summary that a majority of his own project staff privately disagreed with, and that he was accused by dismissed team members David Saunders and Norman Levine of having predetermined before the study began.
NL
Active 1966 – 1968
Electrical Engineer, Condon Committee
A University of Colorado electrical engineer and Condon Committee staff member who, together with David Saunders, obtained a copy of coordinator Robert Low's August 1966 "trick" memo from project files and concluded it proved the study's outcome had been decided in advance. Levine and Saunders were both fired by Edward Condon on February 9, 1968 after the memo's contents began circulating outside the project, a dismissal that became national news once journalist John G. Fuller reported on it in Look magazine three months later. Levine co-authored, with Saunders, the 1968 book UFOs? Yes! Where the Condon Committee Went Wrong.
GC
1908 – 1974
Astronomer, Yale University; Chairman, National Academy of Sciences Review Panel
A celestial-mechanics astronomer who spent nearly three decades at the U.S. Naval Observatory before joining Yale's faculty in 1963, Clemence chaired the twelve-member National Academy of Sciences panel convened in late 1968 to independently assess the scope, methodology, and findings of the Condon Report. After a six-week review, the panel concluded the study's scope and methods were "well chosen, in accordance with accepted standards of scientific investigation" and that extraterrestrial visitation was "the least likely explanation" for the cases reviewed — an endorsement critics note assessed the report's methodology rather than independently re-investigating any of its underlying cases.
EH
Professor of Mathematics, Texas Technological College
Joined the expanded professors' team observing the Lubbock Lights in later 1951 sightings, adding a sixth trained scientific observer to the group's ultimately unsuccessful attempts to instrument the lights' altitude and speed.
Founder & Chief Scientist, NARCAP; Former NASA Research Scientist
A former NASA Ames Research Center scientist (1967–1986/88) with a Ph.D. in experimental psychology, Haines founded the National Aviation Reporting Center on Anomalous Phenomena (NARCAP) in 1999–2000 to apply formal aviation-safety methodology to pilot and aircrew UAP reports. He led NARCAP's Technical Report #10, the only independent formal investigation of the November 2006 O'Hare International Airport sighting, which found the witness pool credible and identified a plausible radar-detection gap without identifying the object. In December 1996, working independently before NARCAP's founding, he conducted a formal digital analysis of the one surviving photograph from the 1949–1950 Norwood Searchlight Incident, finding the object's upper-right sixth unilluminated and roughly three distinct luminous sources near its perimeter. In 1988, working independently of NASA, he examined dust samples taken from the Knowles family's car after their Mundrabilla encounter and reported that material from the vehicle's interior differed from material sampled off its exterior — a finding cited by proponents but never independently replicated or published in a peer-reviewed venue.
AB
fl. 1988–1989
Former Regional Director, South Australian Bureau of Meteorology
A retired meteorologist commissioned by Popular Astronomy editor Ian Ridpath to investigate both 1988 Nullarbor sightings. Brunt's 1989 report in The Skeptic reconstructed the exact upper-air temperature soundings from the Forrest weather station for both incident dates, finding a pronounced temperature inversion on each night consistent with a superior mirage — the same atmospheric-refraction phenomenon behind Queensland's "Min Min Lights" — and concluded the Knowles family most likely saw the distorted, magnified image of an oncoming vehicle's headlights.
Astronomer, Adler Planetarium
Astronomer at Chicago's Adler Planetarium who told reporters in January 2007 that atmospheric conditions on November 7, 2006 were "right for" the formation of a hole-punch cloud, lending outside scientific credibility to the FAA's proposed weather explanation for the O'Hare International Airport sighting.
CEO, Applied Physics
Physicist and CEO of Applied Physics, a research group behind a widely discussed 2021 paper on theoretically constructible warp drives. Martire led a 2024–2025 team analysis, alongside physicist Brandon Melcher, examining the O'Hare sighting's reported flight characteristics through the lens of warp-bubble physics as a thought experiment, while explicitly concluding "the statistical probability that this object was an alien craft is extremely low."
Physicist, Applied Physics
Physicist with Applied Physics who co-led the group's 2024–2025 warp-bubble-physics analysis of the O'Hare sighting alongside Gianni Martire. Melcher stated plainly that "the statistical probability that this object was an alien craft is extremely low," while also declining to endorse the FAA's hole-punch-cloud explanation as complete.
Seismologist, British Geological Survey
British Geological Survey seismologist whose peer-reviewed 2006 paper "The Enigmatic Bala Earthquake of 1974," published in Astronomy & Geophysics, remains the definitive scientific account of the magnitude 3.5 ML earthquake that struck the Berwyn Mountains on January 23, 1974, confirming its magnitude, timing, and the search-and-rescue response the coincident lights and tremor triggered.
Assistant Director, McMath-Hulbert Observatory, University of Michigan
Professional astronomer who publicly stated in the days after the February 24, 1959 Killian sighting that "there is no astronomical explanation of the reported sightings," independently ruling out the Air Force's initial Belt-of-Orion misidentification theory from a scientific rather than eyewitness standpoint.
Physicist; Founder, UNICAT Project
Founded the UNICAT Project to apply rigorous quantitative analysis to well-documented UFO cases. His November 1992 reanalysis of the Killian sighting, "Blue Book Pearls: Capt. Killian's Case," used Killian's own reported angles and comparative size estimates to argue the Air Force's KC-97/B-47 refueling explanation could not survive basic trigonometry or human visual-resolution limits, concluding the case should be classified "Unexplained." Also translated Daniel Perisse's 1987 MUFON symposium paper on the Deception Island Sightings into English, the source document for most of that case's surviving technical detail.
Former Physicist, NZ Department of Scientific and Industrial Research (DSIR)
Published a detailed retrospective optical re-analysis of the December 1978 Kaikōura footage in the New Zealand Skeptic in 2000, arguing that Bruce Maccabee's original 1979 calculations had assumed an incorrect camera focal length and that the filmed lights were geometrically consistent with a distant commercial squid boat's twin lamp rigs roughly six kilometres from the aircraft. His analysis remains the most technically detailed rebuttal of the case's anomalous interpretation.
FZ
1920 – 1988
Doctor of Science; Docent of Cosmology, Moscow Aviation Institute
Widely regarded as the founding father of Soviet ufology. A Moscow Aviation Institute cosmology lecturer and author of more than forty popular astronomy books, Ziegel became a national sensation after an extensive November 10, 1967 report on UFO sightings broadcast on Soviet central television, after which he solicited thousands of firsthand witness accounts from across the USSR. He co-founded the first officially tolerated Soviet UFO research commission, establishing the amateur civilian network that regional investigators such as Valeri Dvuzhilny operated within nearly two decades later during the Dalnegorsk Height 611 Crash.
YP
fl. 1978 – 1990
Physicist, Institute of Terrestrial Magnetism, Ionosphere & Radio Wave Propagation (IZMIRAN)
Directed "Setka-AN" (also reported in Western press as simply "The Network"), the USSR Academy of Sciences' centralized, roughly twenty-institute program for systematically logging and evaluating Soviet UFO reports between 1978 and 1990 — by some accounts the largest official government UFO investigation ever conducted, examining on the order of 3,000 reports and finding the great majority explainable by rocket launches, satellite reentries, and other aerospace or atmospheric activity. Some material from the Dalnegorsk Height 611 Crash was examined at IZMIRAN, Platov's own institute, and he is on record linking the wider 1986–1987 Primorsky Krai UFO wave to mundane technical and aerospace activity rather than an anomalous origin. In 2000, Platov co-authored a retrospective in the Bulletin of the Russian Academy of Sciences with Ministry of Defense counterpart Boris Sokolov — whose separate military program provides institutional context for the classified handling of the Kapustin Yar UAP Sighting — reaffirming that over 90% of the archive's cases were mundane.
LG
fl. 1977 – 1995
Research Fellow, Sternberg Astronomical Institute, Moscow
Led the USSR Academy of Sciences' scientific analysis of the Petrozavodsk Phenomenon beginning ten days after the September 20, 1977 sighting, working with MEPI engineer-physicist D. Menkov and researcher I. Petrovskaya to triangulate the object's altitude and scale from witness testimony. Co-authored the Academy's October 1977 preliminary report, which found it "unfeasible to satisfactorily understand" the phenomenon from available data. Continued specialist analysis of the case for nearly two decades (Gindilis & Kolpakov, RIAP Bulletin, 1995) and remained one of the most persistent technical critics of the rocket-launch explanation later proposed by James Oberg.
IH
1928–2018
Astronomer, National Research Council of Canada; formerly Dominion Observatory
A meteor-spectroscopy specialist who ran the twelve-station Meteorite Observation and Recovery Project (MORP), Halliday was consulted directly on the visual sightings at Sudbury during the November 1975 CFS Falconbridge incident. He told reporters that unusual atmospheric phenomena could be involved, that observers with no fixed point of reference commonly misjudge a light source's distance and altitude, and that witnesses might in some cases have been watching an ordinary aircraft whose engine noise was carried away from the ground by atmospheric refraction.
TM
fl. 1980s–present
Canadian Amateur Satellite-Tracking Analyst; Contributor, SeeSat-L
Widely regarded as one of the world's foremost civilian experts on observing and calculating the orbits and reentry decay of Earth satellites, active for decades on the SeeSat-L observer network. In April 2012, after being contacted by James Oberg at the request of British astronomer Ian Ridpath, Molczan matched the December 11, 1996 Fox Lake / Yukon mass sighting to the reentry of the second-stage rocket booster (catalog no. 1996-069B/24671) that had placed the Russian satellite Cosmos 2335 into orbit earlier the same day, publishing the supporting orbital calculations on SeeSat-L. He was candid that the identification does not, on its own, account for every specific witness claim (reported hovering, car-electronics interference), attributing the gap to the well-documented fallibility of human depth perception against an unfamiliar, high-altitude light source rather than to any flaw in the orbital match itself.
HZ
fl. 1990s–2010s
German Satellite Reentry & Orbital Decay Analyst
An independent satellite-tracking specialist who, following Ted Molczan's 2012 identification of the December 1996 Fox Lake / Yukon sighting as the reentry of the Cosmos 2335 rocket booster, independently recalculated the object's decay trajectory using his own, more precise reentry-modeling method. Zimmer's figures for the booster's position and velocity during breakup matched Molczan's original identification closely, providing a second, methodologically independent confirmation of the conventional explanation.
JO
Theoretical Physicist; Director, Los Alamos Laboratory; Student of Sanskrit
Scientific director of the Manhattan Project's weapons laboratory and, unusually among physicists, a genuine reader of Sanskrit: he began formal study under Arthur W. Ryder at Berkeley in 1933, read the Bhagavad Gita in the original, and called it "the most beautiful philosophical song existing in any known tongue." In NBC's 1965 documentary The Decision to Drop the Bomb, filmed while he was dying of throat cancer, he recalled that the verse "Now I am become Death, the destroyer of worlds" (Gita 11:32) came to mind at the Trinity test — a line frequently and wrongly cited online as evidence that the Mahabharata itself describes nuclear weapons. Oppenheimer never made that claim himself.
AR
1877 – 1938
Professor of Sanskrit, University of California, Berkeley; Oppenheimer's Teacher
Harvard-trained Sanskritist who joined Berkeley's faculty in 1906 and headed its Sanskrit department until his death mid-lecture in 1938. Published widely used English translations of the Panchatantra (1925), the Bhagavad Gita (1929), and Kalidasa's Shakuntala and Meghaduta. Privately taught J. Robert Oppenheimer alongside enrolled students beginning in 1933 and gave him the copy of the Gita he kept by his desk; Ryder's own rendering of verse 11:32 — "Death am I, and my present task / Destruction" — is the direct ancestor of Oppenheimer's famous Trinity paraphrase.
GD
1927 – 1992
Archaeologist; Excavator of Mohenjo-daro; Author, "The Mythical Massacre at Mohenjo-Daro" (1964)
American archaeologist specializing in South Asia who directed the final major excavations at Mohenjo-daro in 1964–65 and taught at the University of Pennsylvania and UC Berkeley. His 1964 article in the Penn Museum's Expedition systematically dismantled the "massacre" reading of the site's skeletal record — 37 skeletons across nine excavation seasons, not contemporaneous, none in the citadel, most in careless burials — concluding there was "no destruction level… no sign of extensive burning, no bodies of warriors clad in armor and surrounded by the weapons of war." His paper targeted the conventional Aryan-invasion theory of the Indus Valley's decline, but it forecloses the "ancient nuclear war" reading of Mohenjo-daro just as completely.
KT
Professor Emeritus of Optical Information Engineering, Gifu University; Principal Modern Researcher of the Utsuro-bune Manuscripts
An engineer by training who came to folklore research through teaching critical thinking, prompted by the 1995 Aum Shinrikyō attacks to teach scientifically minded students how to evaluate paranormal claims. He began examining the original utsuro-bune manuscripts in 1997 and published his English-language study, "Did a Close Encounter of the Third Kind Occur on a Japanese Beach in 1803?", in Skeptical Inquirer 24(4) in July/August 2000, demonstrating that most of the manuscripts' place names are fictitious. In 2014 he identified the Banke bunsho, which supplied the story's only verifiable place name (Sharihama, in present-day Kamisu City). He retired from Gifu University in March 2013 and remains the field's leading authority — a skeptic who has consistently argued the object as described does nothing a boat could not do.
Independent Scientist; Photographic Computer-Enhancement Analyst
An independent scientist working at a Southern California aerospace facility, unrelated to his personal interest in UFOs, Nathan volunteered his own computer-enhancement expertise to the Los Angeles NICAP Subcommittee's (LANS) investigation of Rex Heflin's 1965 photographs beginning in 1968. His analysis found no evidence of a supporting string or model, identified the dark band around the photographed object as likely particulate matter, and detected a wedge-shaped light feature on the object's underside consistent with Heflin's own account of a rotating light beam — a finding independently reproduced by the peer-reviewed 2000 reanalysis of the recovered original photographs.
Aerospace Scientist & Physicist
An aerospace physicist who conducted his own independent photographic analysis of Rex Heflin's 1965 UFO photographs in the 1960s using Marine Corps-supplied copies, Wood learned of the 1993 reappearance of Heflin's lost original Polaroids from author Martin Caidin and joined Ann Druffel and Eric Kelson in the peer-reviewed 2000 reanalysis published in the Journal of Scientific Exploration, which found no supporting string or model in the recovered originals and concluded the photographic evidence remained "totally consistent" with Heflin's own account.
Computer-Imaging & Photo-Enhancement Specialist
A computer-imaging specialist who contributed nonlinear scale-stretch digital enhancement techniques to the 2000 Journal of Scientific Exploration reanalysis of Rex Heflin's UFO photographs, working alongside Ann Druffel and Robert M. Wood. Kelson's enhancement of the recovered original Polaroids detected a previously unreported smoke trail behind the photographed object in Heflin's third photograph, helping establish photographic continuity between the craft images and the disputed fourth "smoke ring" photograph.
Biochemist; Deputy Administrator, National Institute for Discovery Science
A biochemist who served as deputy administrator of Robert Bigelow's National Institute for Discovery Science (NIDS), overseeing the organization's field investigations of anomalous phenomena, including the well-witnessed St. Clair County Triangle Sightings and NIDS's long-running Skinwalker Ranch research, which he later co-authored a book about.
AC
1917–2008
Science Writer, Futurist, and Science Fiction Author
Best known for pioneering the concept of geostationary communications satellites and for later novels including 2001: A Space Odyssey, Clarke was invited to comment publicly on the June 1954 BOAC Centaurus sighting. He judged it "undoubtedly one of the finest sightings ever recorded from the viewpoint of the authenticity of the witnesses," while concluding the objects "were obviously not solid bodies" and that, given the many distinct kinds of atmospheric mirage, "speculation is fruitless" without more rigorous study — a position later analyses by Gordon Thayer and Martin Shough would substantially vindicate.
PG
1926 – 2000
Research Director in Astrophysics, CNRS (France)
French astrophysicist and planetary-science research director at the Institut d'Astrophysique du CNRS in Paris, one of a small number of credentialed French scientists willing to treat select UFO reports as a serious open question. Personally investigated the Valensole case alongside Aimé Michel and Jacques Vallée in the years following the encounter.
LA
1911 – 1988
Physicist, University of California; Robertson Panel Member
A radar specialist and Manhattan Project veteran (he flew as a scientific observer on the Hiroshima mission) who went on to win the 1968 Nobel Prize in Physics for his work on subatomic particle resonance states, and later co-proposed the asteroid-impact extinction hypothesis with his son Walter. As a Robertson Panel member, Alvarez led the technical case that the Tremonton, Utah film's objects were most likely sunlit seagulls rather than the Navy photo lab's "self-luminous" verdict, and separately debunked two "cosmic ray" UFO-correlation claims as ordinary instrumental artifacts.
LB
Geophysicist; President, Associated Universities, Inc.; Robertson Panel Member
An ionospheric-radio pioneer from the 1928–30 Byrd Antarctic Expedition who later proposed and became known as the "Father of" the 1957–58 International Geophysical Year, while serving as president of Associated Universities, Inc. Berkner joined the Robertson Panel only on the afternoon of its third day, arriving after the Chairman had already outlined the evidence to the rest of the group, but reviewed and approved the panel's rough draft report before the other four members finalized it. He proposed a "doppler filter" as a technical fix for the radar mutual-interference problem the panel identified as a source of some sightings.
SG
Physicist, Brookhaven National Laboratories; Robertson Panel Member
Co-discoverer of electron spin (with George Uhlenbeck, 1925) who led the wartime Alsos Mission's scientific intelligence effort to determine how close Nazi Germany had come to an atomic bomb, then chaired Brookhaven's physics department through most of the 1950s. On the Robertson Panel, Goudsmit argued that even if extraterrestrial artifacts existed, they would belong to the ordinary domain of natural phenomena subject to scientific study — a position Robertson himself explicitly disagreed with, believing such artifacts would instead be a matter of urgent, unifying international concern.
TP
Astronomer; Deputy Director, Johns Hopkins Operations Research Office; Robertson Panel Member
A Yale-trained, Oxford-educated astrophysicist who reported on the Bikini atomic tests before deputy-directing Johns Hopkins's Operations Research Office. Page later co-edited the 1972 book UFO's: A Scientific Debate with astronomer Carl Sagan. In a 1992 letter to researcher James Klotz, Page became the only Robertson Panel member to go on record that Robertson told the group in a private opening session that "our job was to reduce public concern," a statement later cited by historian Michael Swords and other researchers as evidence the panel's debunking conclusion was substantially predetermined before its formal evidentiary review began.
PS
1900 – 1986
Physicist; developer of the WWII-era proximity fuze; patent holder on Nike missile guidance systems
A Greek-American physicist credited with wartime proximity-fuze development, Santorini was placed in charge of the Greek Army's own 1946 investigation into "ghost rocket" reports over Macedonia and Thessaloniki. He later told researchers that the Greek investigation was abruptly halted after Greek officials conferred with US defense officials, and that he had been warned to keep silent, citing fears that admitting the technology's existence would reveal a threat against which there was "no possibility of defense."
LL
1897 – 1985
Meteor Astronomer, University of New Mexico; Founder, Institute of Meteoritics
Founder and director (1945–1966) of the University of New Mexico's Institute of Meteoritics, and the Air Force's principal scientific consultant on the "Green Fireballs" phenomenon reported around Los Alamos, Sandia, and the White Sands/Holloman corridor beginning in December 1948. After plotting flight paths and interviewing more than a hundred witnesses, La Paz concluded the objects' flat trajectories, silence, and lime-green color were "atypical" of ordinary meteors and, in his professional judgment, likely artificial. He personally witnessed one himself on December 12, 1948 near Starvation Peak, later telling the classified February 16, 1949 Los Alamos conference — attended by Edward Teller, Norris Bradbury, Frederick Reines, and Joseph Kaplan — that the event was "most certainly not a conventional meteorite fall." His persistent dissent led directly to the creation of Project Twinkle, the Air Force's 1950–51 instrumented fireball-observation program headquartered at Holloman Air Force Base — the same base tied to the July 1951 White Sands radar-visual-photographic sighting. La Paz publicly disputed Twinkle's 1951 conclusion that the fireballs showed "no indication" of being anything but natural.
CT
1906 – 1997
Astronomer; Discoverer of Pluto; Chief of Optical Measurements, White Sands Proving Ground
Self-taught Kansas farm boy who discovered the planet Pluto on February 18, 1930 at Lowell Observatory at age 24, then spent fifteen more years there discovering hundreds of asteroids, a comet, and several star clusters. After joining White Sands Proving Ground in 1946 as Chief of Optical Measurements, he later founded the astronomy department at New Mexico State University (1955–1973). On August 20, 1949, in his Las Cruces backyard, Tombaugh and two family members watched a rigid formation of six-to-eight yellowish-green rectangular lights cross 50–60° of sky in about three seconds — a sighting Project Blue Book still catalogues as an official Unknown. He explicitly rejected an extraterrestrial-craft interpretation, favoring an unconfirmed natural-optical explanation, and reported a second, far brighter (magnitude −6) object at a White Sands observatory a year or two later. Widely regarded as the most credentialed professional astronomer ever to report an unexplained aerial phenomenon.
GS
Director, Voronezh Geophysical Laboratory
The scientist most closely associated with the official investigation of the Voronezh Landing. Silanov led a small team from the Voronezh Geophysical Laboratory to the Yuzhny Park site in early October 1989, using a dowsing-style technique he called "biolocation" to trace an alleged landing outline and reporting anomalous magnetic-field and radiation readings, plus a rock sample he initially described to TASS as being of unidentified composition. His findings were the primary scientific basis cited in TASS's October 9, 1989 report. Within weeks, however, Silanov himself began publicly distancing his work from how it had been reported, telling the newspaper Sotsialisticheskaya Industriya, "don't believe all you hear from TASS — we never gave them part of what they published," and later stating the supposedly unidentified rock was ordinary hematite iron ore common to the region. His shifting, increasingly cautious public statements — genuine scientific reassessment or after-the-fact damage control, depending on the source consulted — are themselves a central piece of evidence in evaluating how the case's physical-evidence claims escalated from field notes into an international sensation.
IS
Docent, Voronezh State University; Chairman, Official City Investigative Commission
A Voronezh State University docent (senior lecturer) appointed by the city administration to chair a formal, multi-disciplinary commission investigating the Voronezh Landing after the story became an international sensation. Surovtsev's commission — which included forensic specialists and nuclear physics, chemistry, and biology researchers, and ran for roughly two months — conducted soil, foliage, and radiological sampling and examined the alleged landing depressions and bent poplar tree at the site. It ultimately reported no confirmed physical evidence of an anomalous landing on local television, attributing the elevated radiation readings city scientists had noted to Chernobyl-derived cesium-137 fallout rather than an extraterrestrial source, and finding the ground depressions and the tree's curvature both pre-dated the alleged event. Surovtsev's investigation remains the single most substantial and credentialed skeptical counter-inquiry into the case.
HP
Active since 1970s
NASA-Affiliated Meteor & Fireball Astronomer
A meteor and fireball researcher who, according to Chris Bledsoe's own account, arrived around 2008 intending to debunk Bledsoe's UAP claims and instead continued an informal, personal interest in the family's case for roughly eight years without publishing a formal conclusion either way. No independent NASA institutional investigation of the case has been documented.
EK
Active 2020s
Project Manager & Hardware Engineer, The Galileo Project
A systems engineer who leads instrumentation work for Avi Loeb's Galileo Project at Harvard. Personally attended and described witnessing one of Chris Bledsoe's "CE5"-style contact events at the June 2025 "Contact in the Desert" conference — later identified by independent analysts, using flight-tracking data, as a conventional aircraft.
Chris Bledsoe Avi Loeb Galileo Project
Astrophysicist, CEFAA Scientific Committee, Chile
An astrophysicist who served on CEFAA's multi-disciplinary scientific committee during its investigation of the November 2014 Chilean Navy helicopter FLIR video. Barrera was specifically tasked with evaluating astronomical explanations for the object, including meteor activity and re-entering space debris, and ruled both out on the grounds that the object's extended ten-minute duration and controlled, level flight profile were inconsistent with a ballistic, decelerating trajectory — one of the few findings in the case that commanded genuine committee consensus.
Psychologist, University of Łódź
Trained at the University of Poznań and later affiliated with the University of Łódź's Institute of Sociology, Kietliński administered psychological testing to Jan Wolski as part of Zbigniew Blania-Bolnar's team and concluded that Wolski showed no symptoms of mental illness and was resistant to suggestion, stating that Wolski was telling the truth or sincerely believed he was.
Psychiatrist, Łódź
Provided the formal psychiatric opinion in the Jan Wolski evaluation, concluding that Wolski showed no signs of mental illness and that his account "cannot be called delusions" — a clinical finding that became one of the Emilcin investigation's most frequently cited results.
Chemical Engineer, Instituto de Ingeniería Química, National University of Tucumán
Head of the university's chemical-industrial laboratory, Tell personally collected 2.343 grams of the white spherical residue found at the Trancas Case site and, within two days of the October 21, 1963 sighting, reported it as 96.48% calcium carbonate and 3.51% potassium carbonate — the case's one genuinely instrumented, institutional data point.
Professional Hypnotist & English Teacher, Masconomet Regional High School
An English teacher who also worked as a MUFON hypnosis consultant, Constantino conducted the individual, separately-scheduled regressive hypnosis sessions with all four Allagash witnesses beginning in January 1989 under the direction of investigator Raymond Fowler, deliberately keeping each man unaware of what the others had said. He later called the sessions "the most intense experience I've had as a hypnotist."
IL
Physicist; Founder, MUFON-CES (1974); Principal Investigator
A physics graduate of the University of Erlangen (1964) who spent his career as an aerospace systems analyst, including work with Daimler-Benz Aerospace/DASA (later EADS). In 1974 he founded MUFON's Central European Section (MUFON-CES) in Feldkirchen-Westerham, which he led until 2014, later directing the Interdisziplinäre Gesellschaft zur Analyse anomaler Phänomene (IGAAP) until his death. Von Ludwiger personally led the investigation into the Greifswald Lights, collecting six videos and more than twenty-five photographs, interviewing over a dozen witnesses, and performing the case's genuine photometric brightness and geometric triangulation analysis — a considerably higher technical standard than most nocturnal-light case investigations receive. He published the full English-language report in May 2000 and directly disputed both later flare-based skeptical explanations on duration grounds.
DD
Active 1990s–present
Director of Research & Academics, M.P. Birla Planetarium, Kolkata
Astrophysicist and longtime director at Kolkata's M.P. Birla Planetarium, one of the earliest planetariums established in the Commonwealth (inaugurated 1963). Shown broadcast footage of the Kolkata UFO Sighting, Duari called it "extremely interesting and strange" before proposing his own leading explanation: an optical illusion caused by clouds reflecting the city's own lights, compounded by atmospheric refraction. He separately considered and rejected both a Comet Holmes fragment and the planet Venus as explanations before suggesting the footage most likely showed "digital trickery" or an optical illusion rather than a real discrete object.
KK
Astro-Particle Physicist, Theory Division, Saha Institute of Nuclear Physics
A senior physicist whose career at the Theory Division of Kolkata's Saha Institute of Nuclear Physics spanned research in neutrino physics, nuclear astrophysics, and nuclear structure, later serving as a visiting professor at the Ramakrishna Mission Vivekananda Educational and Research Institute. Rendered "Kamalesh Kar" in most contemporary press coverage, he offered an independent, narrowly technical comment on the broadcast Kolkata UFO Sighting footage: "A cosmic body cannot change its appearance so rapidly," while cautioning that "it is very difficult to draw any conclusion based on television pictures" alone. His objection rules out a literal misidentified star, planet, or comet without addressing Debiprosad Duari's separate non-astronomical cloud-reflection theory.
ZE
Active 2000s–present
Director, TÜBİTAK National Observatory (TUG)
Director of Turkey's national astronomical observatory, part of TÜBİTAK, the country's Scientific and Technological Research Council. Eker signed the observatory's brief preliminary report on a 35-minute sample of the Yeni Kent Compound Sighting footage, submitted January 31, 2008. The report found no evidence of computer animation or studio fabrication, while explicitly stating this did not confirm an extraterrestrial origin, flagging internal timestamp inconsistencies, and noting that a non-digital hoax "cannot be proven" not to have occurred.
OD
Active 1990s–present
Astrophysicist; Director, Ulupınar Observatory, Çanakkale Onsekiz Mart University
A credentialed Turkish astrophysicist who publicly argued that ordinary camera defocusing and extreme zoom technique can render mundane light sources such as street lamps unrecognizable on video, directly rebutting claims made about the Yeni Kent Compound Sighting footage. He criticized the Sirius UFO Space Sciences Research Center for promoting the case without matching scientific credentials, and argued that a genuine, repeated extraterrestrial presence would more plausibly contact government or scientific institutions than a single night watchman.
AB
Active 2010s–present
Canada Research Chair in Planetary Astronomy; Associate Professor, UBC Department of Physics and Astronomy
An active satellite-megaconstellation researcher who works with the International Astronomical Union's Centre for the Protection of the Dark and Quiet Sky from Satellite Constellation Interference. Co-author of a September 2021 peer-reviewed study (with researchers at the University of Regina and University of Toronto) finding that satellite megaconstellations produce their worst light-pollution impact near 50 degrees latitude — specifically naming Vancouver, Calgary, Regina, and Winnipeg. The primary scientific voice identifying and explaining the Vancouver Starlink Satellite Train Sighting of August 19, 2022, in which he detailed both the deployment physics behind the "train" appearance and the broader space-traffic and dark-sky concerns it raises.
JT
Active 1984–present
Director of Space Science Education, Oregon Museum of Science and Industry (OMSI)
A Portland State University-trained science educator who joined OMSI in 1984 and managed its Kendall Planetarium for twelve years before becoming Director of Space Science Education, with 38 years of public astronomy-education experience by 2022. Provided independent Pacific Northwest corroboration of the Starlink identification for the Vancouver Starlink Satellite Train Sighting, explaining both the satellites' visor shielding and their interference with observatory imaging.
Digital-Imaging Analyst, CEFAA Scientific Committee, Chile
A digital-imaging analyst who worked on CEFAA's technical review of the November 2010 El Bosque Air Base UFO video, concluding the object "moved at a speed far superior to any flying object of known manufacture." His speed characterization became a focal point for skeptical critics, including Robert Sheaffer, who argued the claim rested on an unverified assumption about the object's distance from the camera — a criticism Vergara has not been reported to have publicly answered.
Entomologist, Cornell University
A Cornell University entomologist consulted by journalist Leslie Kean in 2012 on whether the object in the El Bosque Air Base UFO video could be a flying insect. Dombroskie offered a hedged assessment — "it's possible, but I would be very surprised" — noting that beetles, a leading insect candidate, are comparatively slow fliers that would typically appear more blurred on video than the sharply defined object shown.
Entomologist, University of Nebraska
A University of Nebraska entomologist who, after consulting departmental colleagues, told journalist Leslie Kean in 2012 that the object in the El Bosque Air Base UFO video "does not seem to be an insect," while also noting that none of his colleagues had an alternative identification to offer — a hedged assessment rather than a firm identification.
Chilean Beetle Specialist
A Chilean beetle specialist consulted directly given her local expertise on whether the object in the El Bosque Air Base UFO video could be a flying beetle. Arias concluded "I would say they were not insects," explaining that flying beetles typically present a distinctive torpedo-shaped silhouette with visible wing motion on video that she did not observe in the footage she reviewed.
Astrophysicist, Harvard-Smithsonian Center for Astrophysics
A Cambridge-trained astrophysicist and one of the world's foremost independent trackers of rocket, missile, and satellite launches, McDowell reviewed and corroborated Vicente-Juan Ballester Olmos and Ricardo Campo Pérez's identification of the Gando Air Base / Canary Islands UFO sightings as U.S. Navy Poseidon C-3 missile tests, alongside British Ministry of Defence satellite-tracking authority D.G. King-Hele. His long-maintained launch-tracking database is one of the most widely cited independent references for identifying rocket- and satellite-related aerial phenomena.
VM
fl. 1978 – 1990
Director, Institute of Terrestrial Magnetism, Ionosphere & Radio Wave Propagation (IZMIRAN)
As IZMIRAN's director, Migulin led "Setka-AN," the USSR Academy of Sciences' 1978–1990 program for cataloging Soviet UFO reports, with physicist Yuli Platov running its day-to-day workgroup. The program's existence and methodology form essential institutional context for how a military case like the Kapustin Yar UAP Sighting was handled internally rather than through public science or press channels.
GC
Director, Institute of Analytical Chemistry, University of Florence
A professor of analytical chemistry and director of the University of Florence's Institute of Analytical Chemistry in the 1950s, and author of a standard Italian textbook on the field, Nozioni di chimica analitica. Within hours of the October 27, 1954 sighting, Canneri and assistant Danilo Cozzi subjected the fibrous sample collected by Alfredo Jacopozzi to microscopic and spectrographic examination for the Florence Stadium Sighting, identifying a fibrous material of notable mechanical strength composed of boron, silicon, calcium, and magnesium — consistent with a borosilicate glass fiber — that browned and left a fusible, transparent residue when heated. The original sample was consumed during testing and no longer exists for modern re-analysis.
DC
fl. 1950s
Assistant, Institute of Analytical Chemistry, University of Florence
Assistant to Professor Giovanni Canneri at the University of Florence's Institute of Analytical Chemistry, and Canneri's named collaborator in the same-day 1954 microscopic and spectrographic examination of the "bambagia silicea" sample recovered after the Florence Stadium Sighting — the analysis that first identified the substance's boron-silicon-calcium-magnesium composition.
HR
Chairman, Department of Physics, Southeast Missouri State University
A solid-state physicist with a 1966 Ph.D. from the University of Missouri–Columbia, Rutledge chaired his department from 1964 to 1982 and organized "Project Identification" in April 1973 in response to a wave of UFO reports around Piedmont, Missouri in the Piedmont Missouri Wave. Over nearly seven years and 427 logged observation-hours, his instrumented, multi-station team calculated speed, altitude, and acceleration data for a subset of sightings it judged genuinely anomalous, while attributing most reports to aircraft and astronomical misidentification. His 1981 book concluded the residual phenomena behaved as though "an intelligence equal to or greater than that of man" were involved — a hedged, carefully qualified claim from a credentialed source that was never independently replicated or published in a peer-reviewed physics journal.
CS
1934 – 1996
Astronomer, Cornell University; Author, Cosmos and The Demon-Haunted World
A prominent astronomer and science communicator whose public engagement with UFO claims was consistently skeptical, grounded in his broader work on scientific literacy and critical thinking. With Cornell colleague Steven Soter, Sagan co-authored a rebuttal to Marjorie Fish's Zeta Reticuli star-map thesis in the Betty and Barney Hill case, arguing the "match" was an arbitrary pattern effectively guaranteed by the number of candidate stars and the freedom to choose viewpoint and connecting lines.
AC
Professor of Radiobiology, Oak Ridge, TN
An Oak Ridge radiobiologist who, with colleague Kimball C. Atwood III, secretly rigged six helium balloons with an aluminum-foil radar target in 1951 and launched them from a laboratory roof, triggering a genuine Air Force radar detection and fighter scramble. Too afraid of the resulting military attention to confess at the time, Conger only acknowledged the hoax publicly years later in a magazine article, after his own son recognized the story cited as a genuine UFO case history in a published book.
Senior Biologist, Oak Ridge, TN
A senior Oak Ridge biologist who, with colleague Alan D. Conger, built and launched a foil-and-balloon radar-decoy hoax from a laboratory roof in 1951, successfully triggering a real Air Force scramble — direct, demonstrated proof that Oak Ridge's own detection-and-response system could be, and was, fooled by a deliberately trivial object.
EL
Active 2019
Physicist; Acting Director, Nuclear Safety Project, Union of Concerned Scientists
Publicly called the NRC's October 30, 2019 decision not to require drone defenses at licensed nuclear plants "irresponsible" on November 4, 2019, arguing the agency's narrow risk framing — developed partly in response to the Palo Verde Nuclear Station Drone Swarm — ignored the broader range of ways a drone could assist a real attack.
PK
Physician, Heinola Clinic, Finland
Examined Aarno Heinonen and Esko Viljo on the evening of the Imjärvi Incident, finding Heinonen's blood pressure abnormally low in a pattern consistent with shock but reaching no specific diagnosis; reported by secondary sources as remarking the presentation resembled radiation exposure, though his clinic had no instrument to test for it.
MT
Professor of Electrophysics, University of Helsinki
Consulted on the Imjärvi Incident and reported to have judged some form of electrical or radiative exposure "not impossible" as a contributing factor to the witnesses' injuries, without endorsing any specific confirmed mechanism.
JB
Civil Engineer & Astronomer; Director, Observatorio Meteorológico-Astronómico de Zacatecas
Mexican civil engineer who studied celestial photography in Paris before founding, in 1878, the astronomical-meteorological observatory in Zacatecas. On August 12–13, 1883, while checking the Sun for sunspots, Bonilla photographed 447 dark objects transiting the solar disk over roughly 3 hours 25 minutes of clear-sky viewing, publishing his account in L'Astronomie in 1886. He telegraphed observatories in Mexico City and Puebla to seek corroboration — neither reported seeing anything — and went on to author Mexico's first modern cosmography textbook before directing Mexico City's National School of Arts and Crafts from 1911 until his death in 1920. The Zacatecas observatory now bears his name.
CF
French Astronomer; Founder, L'Astronomie
Prolific French astronomer and science popularizer who founded the Société astronomique de France and its journal L'Astronomie in 1883 — the same journal that, in January 1886, published José Bonilla's account of 447 objects photographed crossing the Sun over Zacatecas in 1883. Flammarion, who had personally examined Bonilla's original plates and under whose Paris circle Bonilla had studied astrophotography, appended his own skeptical editorial judgment that the objects were most likely birds, insects, or dust near the telescope's lens — the case's first, and for well over a century its only widely circulated, proposed explanation.
Space Physicist, Universidad Nacional Autónoma de México (UNAM)
Space physicist at UNAM who, with María de la Paz Ramos Lara and Guadalupe Cordero Tercero, published a 2011 preprint reinterpreting José Bonilla's 447 counted objects as fragments of a comet that had recently broken apart, passing within roughly 538–8,062 km of Earth's surface. The team's calculations, drawn from Bonilla's own transit-time data, estimated individual fragments 46–795 meters across and a parent-body mass potentially exceeding that of Halley's Comet — an interpretation subsequently challenged on geometric and physical grounds by independent astronomers.
Historian of Science, UNAM
Historian of science at UNAM who co-authored the 2011 reanalysis of José Bonilla's 1883 Zacatecas observations with Héctor Javier Durand-Manterola and Guadalupe Cordero Tercero, contributing the historical-documentary reconstruction of Bonilla's original observing log and timeline that the team's distance and mass calculations were built on.
Geophysicist, UNAM Institute of Geophysics
Geophysicist at UNAM's Institute of Geophysics and third co-author of the 2011 reanalysis of the Bonilla Solar Transit Photographs case, contributing to the team's mass and composition estimates for the proposed cometary fragments alongside Héctor Javier Durand-Manterola and María de la Paz Ramos Lara.
ML
Active 2011–present
Dutch Astronomer & Satellite/Meteor-Tracking Researcher, Leiden University
Dutch archaeologist-turned-astronomer known for satellite and meteor tracking work affiliated with Leiden University, who publicly challenged the 2011 comet-fragment hypothesis for the Bonilla Solar Transit Photographs case on geometric grounds — arguing that Earth's rotation and orbital motion during the multi-hour 1883 observation window would have required an implausibly wide debris stream to remain invisible from nearby Mexico City and Puebla, and favoring ordinary dust or misperception as more parsimonious explanations.
PP
Active 2011–present
Astronomer & Science Writer ("Bad Astronomy")
American astronomer and science communicator, author of the "Bad Astronomy" blog, who published a detailed public rebuttal of the 2011 comet-fragment hypothesis for the Bonilla Solar Transit Photographs case — arguing a genuinely fragmenting comet could not plausibly stay confined to a debris corridor narrow enough to explain the total lack of corroborating sightings, and that the total absence of an accompanying meteor shower is a serious, unresolved problem for the theory. Plait favored flocks of birds or an unidentified atmospheric phenomenon as the more likely explanation, while agreeing that Bonilla genuinely photographed something unexplained.
📰

Researchers, Journalists & Attorneys

311
GB
Active since 1980s
Aviation & Science Journalist; Author, Flight 427: Anatomy of an Air Disaster
A twice-honored Irish Science Journalist of the Year whose aerospace and science reporting has appeared in the Irish Times, the Irish Independent, and New Scientist, and author of the air-crash investigation book Flight 427: Anatomy of an Air Disaster. In the days after the November 2018 Irish airspace UFO sightings, Byrne told Irish media that "in all probability they were meteorites," noting that meteorites commonly enter the atmosphere at a low trajectory that can be mistaken for a nearby, level object by a fast-moving aircrew.
MC
1920 – 2019
Former Apollo communications-systems contractor engineer; Author
Worked as a contractor engineer on Apollo's communications and data-processing hardware, then, in his 1978 book Our Ancestors Came From Outer Space, publicized a heavily embellished retelling of the Apollo 11 UAP sighting and alleged a deliberate NASA "cosmic Watergate" cover-up. Investigator James Oberg's later research found no evidence Chatelain held the senior insider role often attributed to him, and the primary 1969 Technical Crew Debriefing transcript does not support the encounter as Chatelain described it.
Journalist (Corriere Mercantile, Il Giornale); Author
Covered the Pier Fortunato Zanfretta case from its first week in December 1978, personally organized its earliest regressive-hypnosis sessions, and became its principal chronicler, authoring Il caso Zanfretta, the case's definitive book-length account, through at least six Italian editions plus an English translation.
ER
UFO Historian; Founding Member, Centro Italiano Studi Ufologici (CISU)
A historian of the Italian UFO phenomenon active since 1976 and a founding member of CISU, Russo situates the Zanfretta case within Italy's record 1978 national UFO wave (roughly 2,300 reports) and coordinated CISU's dedicated 2018 retrospective conference on that year, applying what he describes as a "critical," not blanket-debunking, methodology.
Researcher
Conducted a detailed on-site field investigation of the "Casa Nostra" villa grounds on April 25, 1980, producing the case's most thorough skeptical reconstruction: identifying a television aerial silhouetted against fir trees as a plausible source for the entity sighting, a tethered horse as the likely source of the ground imprint, and reassessing reported "giant footprints" as ordinary puddles.
MJ
1900 – 1959
Astronomer; Author, The Case for the UFO (1955)
Author whose 1955 book prompted Carl M. Allen's annotated letters to the Office of Naval Research, unwittingly setting the fabricated "Philadelphia Experiment" legend in motion. Had no documented connection to physicist T. Townsend Brown, whose name authors grafted onto the story two decades after Jessup's 1959 death.
Carl M. Allen Philadelphia Experiment Case File #192
DK
1897 – 1988
Author; Long-Serving Director, NICAP
Retired Marine Corps major and prominent flying-saucer author who publicly challenged the Air Force's temperature-inversion explanation days after the Samford press conference, telling reporters he believed some 1952 sightings would "prove to be of interplanetary origin." Joined the founding board of the National Investigations Committee on Aerial Phenomena (NICAP) when T. Townsend Brown established it in October 1956, then became NICAP's long-serving director in 1957 after Brown's removal, building it into the era's leading civilian UFO research organization for the next twelve years.
JK
1930 – 2009
Author, journalist, and anomalies researcher
Main anomalies researcher and author of Operation Trojan Horse and The Mothman Prophecies. Coined the term "Ultraterrestrial" and formulated the hypothesis that UAPs represent a coexisting, non-human Earth presence that shapes human culture through psychological and mythological masks. Developed concepts of "window areas" and electromagnetic anomalies associated with UAP zones.
Ultraterrestrial Jacques Vallée MIPs
RH
Author, speaker, and nuclear-silo UAP investigator
Spent over four decades gathering declassified military documents and witnessing testimonies from over 150 retired military launch officers regarding UAP sightings over nuclear weapons installations. Wrote the definitive research book UFOs & Nukes. Organized the landmark 2010 National Press Club conference where former launch officers publicly testified that UAPs had disabled active ICBMs.
JC
Contemporary
Independent researcher; leading skeptic of the Echo Flight UFO narrative
Son of Echo Flight crew commander Eric Carlson. Author of the self-published, free-to-read book Americans, Credulous (also circulated as "Echo Flights of Fantasy"), which argues at length that no UFO was involved in the March 16, 1967 Echo Flight shutdown and that the narrative built around it by Robert Salas and Robert Hastings misrepresents his father's and Walt Figel's actual recollections. His position is itself disputed by other researchers, including Hastings and Kevin Randle, who note Figel's own recorded statements describing a "large round object" report predate Carlson's book.
RD
UAP historian, author, and publisher
One of the leading academic historians researching UAPs. Author of the two-volume historical work UFOs and the National Security State. Formulated the "Breakaway Civilization" hypothesis, proposing that compartmented Special Access Programs and private defense contractors have developed anti-gravity and energy propulsion tech far beyond public science, using classified black budgets.
Breakaway Civilization Black Budgets National Security State Wonsan-Sunchon UFO Incident
SF
1934 – 2019
Nuclear physicist; civilian Roswell investigator
Worked on classified nuclear and fusion propulsion for GE, GM, Westinghouse, and McDonnell Douglas. Revived the Roswell case in 1978 through his interview with Jesse Marcel. Coined "Cosmic Watergate." Primary defender of MJ-12 documents. Gave 700+ lectures at 600+ universities. The most persistent and well-credentialed civilian Roswell investigator in history.
Roswell Jesse Marcel MJ-12
GK
Investigative journalist, KLAS-TV Las Vegas
Broke the Bob Lazar/Area 51 story in 1989. Co-authored Hunt for the Skinwalker with Dr. Colm Kelleher. Played a key role in facilitating the 2017 NYT article revealing AATIP. One of the few mainstream journalists with decades of consistent, credible UAP reporting. Connected to Bigelow, Lazar, Puthoff, and virtually every major UAP figure since the 1980s.
JC
Documentary filmmaker; co-host, "Weaponized" podcast
Independent filmmaker (Bob Lazar: Area 51 & Flying Saucers, Hunt for the Skinwalker) who, working with journalist George Knapp, has published a series of leaked U.S. Navy UAP photographs and videos since 2021, including the USS Omaha spherical-object footage and the "pyramid" UAP video filmed aboard the USS Russell. Also revealed the leaked "Mosul Orb" still image in January 2023 and, working with journalist Dustin Slaughter's 2025 FOIA lawsuit, the full four-second video. Pentagon spokespeople have confirmed several of his released materials as authentic Navy-recorded imagery under review by the UAP Task Force, without confirming the objects' identity or origin. Critics note he does not disclose his sources and that his on-camera framing consistently favors extraterrestrial interpretations.
DS
Active 2023–present
Independent investigative journalist
Filed a broad Freedom of Information Act request with the U.S. Air Force and its National Air and Space Intelligence Center (NASIC) in 2023 seeking UAP-related video material, and, after what he described as agency stonewalling, sued both agencies in 2024. That lawsuit produced the actual four-second "Mosul Orb" video — not merely the still image Jeremy Corbell and George Knapp had leaked in 2023 — which he released publicly via their "Weaponized" podcast on July 1, 2025, a legally-compelled disclosure distinct from an unverifiable leak.
DS
Constitutional attorney (Harvard Law); founder, New Paradigm Institute
Legal heavyweight behind the Pentagon Papers, Karen Silkwood, Watergate, and Iran-Contra cases. Now provides legal counsel to UAP whistleblowers including Lue Elizondo. Founded the New Paradigm Institute for disclosure advocacy. Actively lobbies Congress on UAP legislation. His decades of landmark cases lend extraordinary institutional credibility to the disclosure movement.
Lue Elizondo New Paradigm Institute Congressional UAP Legislation
Investigative journalist; founder, Public
Reporting extensively on an alleged DoD program he calls "Immaculate Constellation" — which he claims maintains classified UAP photos and videos hidden from Congress. Has testified before the House Oversight Committee. Published the Twitter Files on government censorship. Frames UAP work as part of broader investigation into government accountability and "Deep State" secrecy.
Immaculate Constellation Congressional Testimony
JL
1942 – 2022
Pilot; son of Learjet inventor Bill Lear
Held every FAA airman certificate and flew 150+ aircraft types, including for Air America (CIA). In 1987, released a statement claiming the U.S. signed a secret treaty with ETs at Holloman AFB in 1964. Instrumental in bringing Bob Lazar to public attention. Helped shift UFO culture toward darker narratives of government-alien collusion. A polarizing but seminal figure.
LH
Investigative journalist; Emmy-winning filmmaker
Won an Emmy for A Strange Harvest (1980) on animal mutilations linked to UAP. Creator of Earthfiles.com. Was custodian of "Art's Parts" bismuth-magnesium metamaterials before selling them to TTSA. Has investigated crop circles, military whistleblowers, and anomalous materials for over 40 years.
Art's Parts TTSA Animal Mutilation
KR
b. ~1949
Retired Lt. Colonel (USA); Roswell investigator
Applied military intelligence methodology to the most systematic Roswell investigation ever conducted. Authored UFO Crash at Roswell and The Truth About the UFO Crash at Roswell. Served in Vietnam and Iraq. Has publicly withdrawn support for witnesses as credibility problems emerged — demonstrating unusual intellectual honesty in the field. Has separately called Nick Mariana's 1950 Great Falls, Montana film "one of the strongest cases supporting the existence of UFOs."
DS
Roswell researcher, author
Co-author of UFO Crash at Roswell (1991) and Witness to Roswell (2007) with Thomas Carey. Suffered credibility damage when he fabricated academic credentials and employment history. Despite this, his fieldwork produced significant witness testimony including the Walter Haut sealed affidavit.
Roswell Witness to Roswell Investigation
TC
b. ~1947
Roswell researcher, author
Co-author of Witness to Roswell (2007), which featured Walter Haut's sealed affidavit. Focused on deathbed testimony and sealed affidavits from military personnel. Produced the most comprehensive witness-focused account of Roswell.
Roswell Haut Affidavit Investigation
DR
b. ~1950s
Optometrist, Ramey Memo analyst
UC Berkeley optics background. Best known for extensive digital analysis of the Ramey Memo using image processing and blind deconvolution algorithms. Claims to have identified phrases including 'the victims of the wreck.' Maintains roswellproof.com. Also conducted an independent geometric and digital re-analysis of the 1950 McMinnville Trent photographs, taking his own measurements at the farm site and building a 3D model to test skeptics' shadow-timing claims.
Roswell Ramey Memo Digital Analysis McMinnville 1950
AB
Independent FOIA researcher
Investigated the Roswell-Battelle-Nitinol connection. Used FOIA to obtain a 1949 Battelle Memorial Institute report on titanium alloys. In 2021, obtained 150+ pages from the DIA on advanced materials including Nitinol. His work on the 'memory metal' chain is widely cited. Separately, in 2011 and 2017–2018 investigated the Wanaque Reservoir Incident, interviewing witness Charles Theodora and publicly identifying (in a claim disputed by other researchers) Claude Coutant as the photographer behind the case's anonymous "beam photo" print set.
Roswell Nitinol Battelle FOIA Wanaque Reservoir Incident
KP
1943 – 2006
Former CIA officer; Roswell skeptical investigator
Investigated Roswell initially as a believer but concluded the debris was from Project Mogul. His book Roswell: Inconvenient Facts and the Will to Believe (2001) is considered the strongest skeptical case. His CIA credentials make his perspective essential for balanced coverage.
Roswell Project Mogul CIA Skeptic
IS
1924 – 1995
Society Columnist, O Globo, Rio de Janeiro
A photographer-turned-journalist who wrote O Globo's daily "Reportagem Social" column from August 1954 until his death, chronicling Rio de Janeiro's elite social life. On September 14, 1957, Sued published an anonymous reader letter describing a "flying disk" that exploded over the beach at Ubatuba, accompanied by three metal fragments, which he passed to APRO investigator Olavo Fontes rather than simply publishing the story as-is.
OF
1924 – 1968
APRO's Brazilian Representative; Physician, National School of Medicine, Rio de Janeiro
A Brazilian physician who served as the Aerial Phenomena Research Organization's representative in Brazil, Fontes took custody of the Ubatuba magnesium fragments from Ibrahim Sued in September 1957, arranged their first laboratory analyses at the Mineral Production Laboratory, and personally traveled the Ubatuba coast searching for the letter's anonymous author, never successfully identifying him. Within weeks he also opened APRO's investigation into farmer Antônio Vilas-Boas's claimed October 1957 encounter, examining him on February 22, 1958 and concluding his skin lesions and other symptoms were consistent with mild radiation exposure — a diagnosis this catalogue's dedicated case file treats as genuinely significant but methodologically unverifiable today, since Fontes's original clinical notes were never published or preserved in full. Fontes's dual role made him the central investigative figure in Brazil's two most significant UFO cases of 1957. As APRO's Brazilian representative, he also attempted, in 1961, an early defense of the older 1952 Barra da Tijuca photographs against an emerging shadow-direction objection, proposing broken foliage as the cause — an explanation that did not survive later, more rigorous scrutiny of the case.
KM
fl. 2003 – present
Brazilian Skeptical Researcher; Founder, Ceticismo Aberto
A Brazilian science writer and skeptical investigator whose 2010 computer-enhanced reanalysis of the Trindade photographs — cross-published with American researcher Tim Printy's SUNlite bulletin — identified cloud formations in the case's first and sixth exposures that appear inconsistent with the fourteen-second interval Barauna described between shots. Working with researcher Rodrigo Moura Visoni, Mori also tracked down and interviewed retired Navy petty officer Edson Jansen Ferreira, one of the few surviving crew members who had actually been on deck during the alleged sighting, adding a rare firsthand rank-and-file account to a case long dominated by officer- and civilian-witness testimony.
CL
1925 – 1988
Co-Founder & Director, Aerial Phenomena Research Organization (APRO)
Co-founded APRO with her husband Jim in January 1952, building the first UFO research organization to maintain a network of volunteer national representatives worldwide, including Olavo Fontes in Brazil. Lorenzen received Fontes's forwarded portion of the Ubatuba magnesium samples in late 1957, publicized the case in the APRO Bulletin and her own 1966 book, and held custody of the remaining fragments for three decades before turning them over to Stanford physicist Peter Sturrock in 1987.
WM
Author, ufologist
Co-author with Charles Berlitz of The Roswell Incident (1980), the first book-length investigation, and, the year before, of The Philadelphia Experiment: Project Invisibility (1979) — the book whose unsourced chapter "The Force Fields of Townsend Brown" first, and falsely, linked physicist T. Townsend Brown to the fabricated USS Eldridge invisibility legend. Later admitted at the 1989 MUFON conference to participating in AFOSI disinformation operations, passing false information to researcher Paul Bennewitz. Also received the MJ-12 documents.
Roswell MJ-12 Disinformation AFOSI Philadelphia Experiment Case File #192
JS
active 1980s–1990s
TV producer; MJ-12 document recipient
In December 1984, received an anonymous roll of 35mm film containing what purported to be briefing papers for 'Operation Majestic-12.' Worked closely with William Moore and Stanton Friedman investigating the documents' authenticity. The origin of the film roll remains unsolved.
MJ-12 Roswell Documents
RD
b. ~1950
AFOSI (Air Force Office of Special Investigations) agent
Admitted to participating in disinformation operations targeting the UFO community, specifically the Paul Bennewitz case. Subject of the documentary Mirage Men (2013). His admitted role in government disinformation is key to understanding how the Roswell narrative has been contaminated. Doty signed the original AFOSI complaint form compiling the August 1980 Manzano Weapons Storage Area security-police sightings before the disinformation campaign against Bennewitz began.
Disinformation AFOSI Bennewitz Mirage Men Case File #116
LK
Physician, health educator, researcher
A Phoenix-based physician who photographed anomalous amber orbs prior to the 1997 mass event and published the definitive book The Phoenix Lights: A Skeptic's Discovery That We Are Not Alone (2004) and documentary. She founded the Phoenix Lights Network.
Phoenix Lights Photography Witness
MS
active 1997
Amateur astronomer, Scottsdale, AZ
Observed the Event One V-formation through a 10-inch Dobsonian telescope at 60x magnification, claiming it resolved into individual conventional airplanes in formation. A leading skeptic witness for the case.
Phoenix Lights Telescope Skeptic
GH
b. ~1951
Real estate appraiser; co-investigator
Close friend and business associate of Bob Lazar. Huff was present during the famous 1989 desert trips to film glowing anomalous lights over Groom Lake on Wednesday nights. Co-founded Tri-Dot Productions with Lazar to produce his explanatory tape.
Lazar / S-4 Groom Lake
LV
Documentary filmmaker and researcher
Director of the 2026 documentary S4: The Bob Lazar Story, which investigates S-4, Groom Lake, and Bob Lazar's claims. Worked closely with George Knapp to bring forward new military witness testimonies.
WW
b. ~1933
Astronomer and NICAP investigator
Hayden Planetarium astronomer who served as primary investigator for NICAP. Conducted the first detailed interviews of Betty and Barney Hill in October 1961, concluding they were highly reliable, intelligent, and sane witnesses.
MO
1927–2000
Psychiatrist & Psychologist, University of Pennsylvania
The most influential researcher on the forensic reliability of hypnosis, Orne demonstrated that hypnotized subjects can confidently produce detailed but confabulated memories indistinguishable, without independent corroboration, from accurate recall. He served as an expert witness in the "Hillside Strangler" case and concluded that any memory recovered through hypnosis requires independent verification — a standard directly relevant to evaluating the hypnotically-recovered testimony central to cases like the Buff Ledge Encounter.
Hypnotist, Buff Ledge Encounter investigation
Conducted the separate regressive hypnosis sessions with Michael Lapp and Janet Cornell at investigator Walter Webb's direction, beginning around 1979, which produced both witnesses' detailed recovered accounts of the alleged 1968 abduction later published in Webb's book.
RP
1910 – 1977
Editor of Fate magazine; science fiction publisher
Co-founded Fate magazine in 1948, publishing Kenneth Arnold’s firsthand account. Hired Arnold to investigate Maury Island and co-authored the 1952 book The Coming of the Saucers. Highly influential in shaping early UFO culture.
FC
1919 – 1975
Maury Island perpetrator; alleged operative
Harold Dahl's harbor-patrol supervisor in Tacoma, WA, who claimed his own follow-up sighting near Maury Island and collected the "slag" samples in 1947. Kenneth Arnold investigated and the FBI concluded the affair was a hoax. Two decades later, Crisman was called before the Orleans Parish grand jury in Jim Garrison's JFK assassination probe; the House Select Committee on Assassinations noted he physically resembled one of the "three tramps" photographed in Dealey Plaza but had an alibi placing him in Oregon that day.
CM
active 1994
Headmaster, Ariel School
The school administrator during the 1994 landing event. Initially skeptical, he attempted to calm the panicked children before collaborating with investigator Cynthia Hind. Later testified to the kids' sincerity, stating they were not coordinating a prank.
CH
1915–2000
UAP Investigator & Publisher
The leading UAP investigator in Africa and a MUFON representative. She conducted the primary investigation at Ariel School, establishing the isolation drawing protocol to prevent witness contamination, and published the definitive case study (Case #96) in UFO AfriNews.
Ariel School MUFON
DC
Active since 1994
Research Associate
Research assistant to Dr. John Mack who accompanied him to Ruwa, Zimbabwe in November 1994. She assisted in conducting and video-recording the psychiatric interviews with the Ariel School children, documenting their emotional states and drawings.
RN
Active since 2008
Filmmaker & Investigator
Director of the documentary Ariel Phenomenon (2022). He spent over a decade conducting follow-up investigations, locating and interviewing the child witnesses as adults across the globe, and restoring the original 1994 BBC and John Mack interview tapes.
GH
Active since 1994
Photographer & Technical Investigator
A local photographer and researcher who assisted Cynthia Hind. He photographed the physical impressions at the Ariel School landing zone within 24 hours of the sighting and conducted magnetic and radiation measurements at the site.
LE
Active since 2000s
Former AATIP Director
Former counterintelligence officer who directed the Advanced Aerospace Threat Identification Program (AATIP), the Pentagon's unit investigating anomalous aerial phenomena, from 2007 until his resignation in 2017. He popularized the Five Observables framework for analyzing UAP performance metrics.
CG
Active since 1970s
Arizona DPS Polygraph Examiner
The highly respected polygraph examiner for the Arizona Department of Public Safety who administered the initial examinations to the logging crew on November 10, 1975, concluding that they were telling the truth. He conducted follow-up tests on Walton and the crew in 1993.
TL
d. ~2011
BBC War Correspondent
A veteran war correspondent who filmed the first BBC video reports and interviews with the Ariel School children in September 1994. Stated that interviewing the children made him feel more uncomfortable than reporting on combat zones due to their genuine, unfeigned state of shock.
Ariel School BBC News
RM
Roderick MacLeish Jr.
active 1994
Attorney, legal counsel to Dr. John Mack
Prominent Boston attorney who represented Harvard psychiatrist Dr. John Mack during the university's 14-month peer-review investigation into his abduction research. MacLeish defended Mack's academic freedom, successfully preventing disciplinary action or tenure revocation.
John Mack Harvard Inquiry Danny Sheehan
BR
1923 – 2014
Professor of Medicine, Harvard; Editor, NEJM
Also known as Dr. Arnold Relman. He chaired the ad-hoc peer-review committee appointed by Harvard Medical School Dean Daniel Tosteson in 1994 to investigate Dr. John Mack's abduction research methods, leading the inquiry into Mack's scientific standards.
John Mack Harvard Inquiry
DT
1925 – 2009
Dean of Harvard Medical School
Appointed the ad-hoc committee to investigate Dr. John Mack's research. Following a 14-month inquiry, he issued a public statement reaffirming Mack's academic freedom and status as a faculty member in good standing, though warning him on clinical practice standards.
John Mack Harvard Inquiry
CB
1914 – 2003
Author — The Roswell Incident (1980); The Philadelphia Experiment (1979)
Prolific author best known for The Bermuda Triangle (1974). Co-authored The Roswell Incident (1980) with William Moore — the first book-length investigation of Roswell, which brought the case to mainstream public attention after 33 years of obscurity. The pair's earlier 1979 book, The Philadelphia Experiment: Project Invisibility, is the original source of the false claim connecting physicist T. Townsend Brown to an alleged Navy invisibility experiment the U.S. Navy has explicitly and repeatedly denied ever took place. Despite later questions about Moore's credibility (he admitted to participating in AFOSI disinformation operations), the Roswell book remains historically significant as the catalyst for modern Roswell investigation.
roswellresearchersauthorsbooks1980Philadelphia ExperimentCase File #192
AC
1911 – 1987
Lead Scientist, Project Mogul
Lead atmospheric scientist on Project Mogul, the classified balloon program the USAF identified as the source of the 1947 Roswell debris. Crary's personal diary is a key document in the skeptical case: his entries indicate that Mogul Flight #4 — the specific flight the Air Force cited — may have been cancelled due to cloud cover on June 4, 1947. His diary is cited by both sides: skeptics see it as supporting a balloon in the area; proponents argue it weakens the specific Flight #4 attribution.
roswellresearchersproject-mogulgovernment
AB
1945 – 2018
Radio Host — Coast to Coast AM
Legendary overnight radio host and founder of Coast to Coast AM. In 1996, Bell received an anonymous package from a military source ("Mr. X") containing layered bismuth-magnesium samples — the "Art's Parts" — allegedly recovered from a 1940s New Mexico crash site. These samples were later acquired by Linda Moulton Howe and analyzed by Dr. Garry Nolan at Stanford. Bell's program served as the primary public platform for UAP witnesses and researchers throughout the 1990s and 2000s.
roswellresearchersmediametamaterials
President, SOBEPS (1971–2007)
Long-serving President of SOBEPS (Société Belge d'Étude des Phénomènes Spatiaux), the Belgian civilian UFO research group that cooperated formally with the Ministry of Defense during the 1989–1990 wave. Under Bougard's leadership, SOBEPS compiled over 2,600 individual witness reports and published two landmark investigative volumes: Vague d'OVNI sur la Belgique (1991) and its sequel (1994). He also authored La Chronique des OVNI (1977), one of the first French-language historical surveys of pre-modern UAP events. Bougard wrote the final editorial dissolving SOBEPS on December 31, 2007, after which COBEPS was founded as its successor.
belgian-waveresearchersSOBEPSBelgiumcivilianinvestigation19891990
Investigative Journalist; UAP Author
Award-winning independent investigative journalist who transformed the mainstream credibility of UAP reporting. In 2000, Kean began systematically investigating UAP cases using journalistic standards rather than advocacy. In 2002, she co-founded the Coalition for Freedom of Information (CFi) and won a 5-year FOIA lawsuit against NASA for UAP-related data. Her 2010 New York Times bestseller UFOs: Generals, Pilots, and Government Officials Go on the Record — with a foreword by John Podesta — is widely credited with breaking the mainstream media taboo on UAP coverage. It features General Wilfried De Brouwer's first-hand account of the Belgian Wave. In 2017, Kean co-authored the landmark New York Times story revealing AATIP, and in 2023 reported on David Grusch's congressional whistleblower disclosures. Her work spans two decades of UAP journalism at the highest levels.
researchersjournalistsauthorsUFOBelgian-waveAATIPGruschNew-York-Times2010coalitionNASA LawsuitKecksburg SightingAlderney UFO SightingLake Cote UFO Photograph
MH
Skeptic; Critic of SOBEPS
Belgium's most prominent skeptic of the 1989–1990 UFO wave and a long-standing critic of SOBEPS. An early believer in the extraterrestrial hypothesis, Hallet translated George Adamski's Inside the Space Ships into French in 1979 before shifting to radical skepticism after researching a biography of Adamski. His 1992 book La Vague OVNI Belge ou le triomphe de la désinformation ("The Belgian UFO Wave or the Triumph of Disinformation") argued that the wave was a media- and SOBEPS-fueled mass delusion, with witnesses misidentifying helicopters, bright planets, and other conventional objects. SOBEPS and independent researchers dispute his conclusions, pointing to simultaneous multi-sensor NATO radar data and military testimony that cannot be accounted for by the mass-misidentification hypothesis.
belgian-waveresearchersskepticscriticsSOBEPShoaxhelicoptermisidentificationBelgium
NASA Aerospace Contractor; MUFON Co-Founder
A prominent aerospace engineer who spent decades working on NASA projects (including Gemini, Apollo, Skylab, and Space Shuttle missions) for companies like McDonnell Douglas. Schuessler co-founded the Mutual UFO Network (MUFON) in 1969 and served as its international director. He was the chief investigator for the Cash-Landrum incident (1980), meticulously documenting the medical records, witness statements, and vehicle damage. Author of the definitive book The Cash-Landrum UFO Incident (1998), he persistently lobbied for government disclosure regarding the physical effects of UAP encounters.
MUFON NASA Cash-Landrum Cash-Landrum Sighting
AG
Founder of Revista UFO; Disclosure Campaign Leader
One of Brazil's most prominent ufologists and the founder/editor of the long-running publication Revista UFO. Gevaerd conducted the landmark July 1997 interview with retired Captain Uyrangê Hollanda, exposing Operation Prato's files to the public. He later led the "UFOs: Freedom of Information Now" campaign, which successfully lobbied the Brazilian Air Force (FAB) to declassify thousands of pages of secret military archives. He was a central figure in international disclosure efforts until his death in 2022.
Journalist and Author
A Brazilian journalist and researcher based in Belém, Pará, who conducted the first comprehensive civilian investigation into the Colares UFO wave. Giese interviewed local residents, clinic doctors, and municipal leaders during the late 1970s and 1980s. In 1991, he published the seminal book Vampiros Extraterrestres na Amazônia (Extraterrestrial Vampires in the Amazon), which became the first comprehensive written documentation of the chupa-chupa wave and the subsequent arrival of the military.
BP
1936 – 2005
Investigative Journalist and Author
An American investigative journalist for the National Enquirer who traveled to Brazil in 1978 to report on the Colares UFO wave. Pratt spent decades investigating UAP encounters throughout Brazil, accumulating hundreds of interviews with witnesses and physicians. He authored the landmark book UFO Danger Zone: Terror and Death in Brazil (1996), which remains the most detailed English-language chronicle of the physical harm and physiological trauma suffered by the witnesses in the Amazon delta.
Ufologist, Author, and Investigator
A prominent Brazilian ufologist, co-founder of the Brazilian Association of Ufologists (APU), and author of several books on the military involvement in ufology, including Militarismo e Ufologia: A Operação Prato (2003). Petit co-conducted the landmark July 1997 interview with retired Captain Uyrangê Hollanda that exposed Operation Saucer's documents, photographs, and film reels to the public. He has spent decades advocating for government declassification.
APU Operação Prato Colares / Operation Prato
UAP Researcher & Author (Wikipedia: Stan_Gordon)
The primary civilian investigator of the 1965 Kecksburg crash. He began collecting witness reports immediately after the event, interviewed key military and civilian figures, and spent decades documenting anomalies in southwestern Pennsylvania. His persistent efforts kept the case in the public consciousness.
Kecksburg Incident Kecksburg Sighting
WHJB Radio News Director (Wikipedia: Kecksburg_UFO_incident#Investigation)
News director at Greensburg's WHJB radio. He was one of the first journalists on scene at Kecksburg, took photographs of the acorn-shaped object in the ravine, and interviewed witnesses. His photographs were confiscated by military intelligence officers, and his subsequent documentary "Object in the Woods" was heavily censored.
WHJB Radio Kecksburg Sighting
MT
1975 – 2009
UAP Researcher & Author
Author of the landmark work "The Cryptoterrestrials", proposing that UAPs are operated by a stealthy, advanced hominid species indigenous to Earth that has co-existed with humanity in secret.
Cryptoterrestrial Fortean
TC
Aviation Historian & UAP Researcher
Pioneered the hypothesis that some UAPs are low-density, macroscopic biomorphic organisms native to Earth's high atmosphere, which feed on electromagnetic currents and can be captured using infrared film.
Atmospheric Organism Infrared
British Astronomer & Science Journalist
His March 1978 Sunday Times article crediting skeptic Philip J. Klass with having explained the 1956 Lakenheath–Bentwaters radar-visual case prompted a rebuttal letter from GCI controller Freddie Wimbledon, reopening public debate on the incident.
British Fortean & UFO Researcher
Collaborated with David Clarke, Martin Shough and Jenny Randles on the 2000s re-investigation of the Lakenheath–Bentwaters incident, tracking down and interviewing the actual Venom aircrews decades after the event — work later published collectively as "the Lakenheath Collaboration." Also co-authored, with Clarke and Randles, The UFOs That Never Were (2000) and, solo, UFO Down? The Berwyn Mountain UFO Crash (2010), the most detailed published investigation of the 1974 Berwyn Mountains Incident. With Clarke, co-authored Out of the Shadows (2002), which contains the fullest published account of both the 1977 RAF Boulmer sighting and the 1957 West Freugh radar incident.
UFO Researcher
Part of the team that relocated and interviewed the Lakenheath–Bentwaters Venom aircrews in the 2000s. Argued that speculative "radar spoofing" theories connected to the case more plausibly belong to the contemporaneous Milton Torres RAF Manston incident than to the Lakenheath events themselves. Authored the only detailed independent technical reanalysis of the 1957 West Freugh radar case, confirming the encounter's core multi-station tracking parameters from his own examination of the primary material.
British UFO Researcher & Author
Prolific British UFO author who joined David Clarke, Andy Roberts and Martin Shough in the 2000s re-investigation of the Lakenheath–Bentwaters incident, helping locate and interview the Venom aircrews whose testimony substantially complicated the case's classic narrative. Also published Margaret Fry's 1990s findings on the 1974 Berwyn Mountains Incident through BUFORA's network, co-authored The UFOs That Never Were (2000) with Clarke and Roberts, and documented the 1957 West Freugh radar case in her own published UFO histories. As a BUFORA investigator, she was among the researchers who examined the March 1993 Cosford Incident and floated the rocket-body re-entry explanation later confirmed in detail by Gary Anthony's trajectory analysis.
British UFO Researcher & Author
British ufologist and psychology graduate who, with longtime writing partner Jenny Randles, led the investigation into the December 1987 Ilkley Moor Incident — arranging the Kodak and British Journal of Photography analyses of the photograph, having the witness's anomalous compass examined at Manchester University, and ultimately receiving copyright of the photograph from the witness himself. Hough's academic background included published research with Dr. Paul Rogers on the psychology of alleged alien-abduction experiencers, appearing in the peer-reviewed journal Imagination, Cognition and Personality. He and Randles co-authored The Complete Book of UFOs and World's Best "True" UFO Stories, the latter containing their own chapter-length account of the Ilkley Moor case.
NR
British-American Author & Ufologist
British-born, Texas-based author of more than thirty books on UFOs, cryptozoology, and government secrecy, and a longtime researcher of declassified Royal Air Force, Air Ministry, and Ministry of Defence UFO files. In Top Secret Alien Abduction Files (2018), Redfern documented the claim that, roughly six weeks after the December 1987 Ilkley Moor Incident, two men identifying themselves as "Jefferson" and "Davis" and claiming RAF Intelligence credentials visited the witness's home seeking his photograph — a visit the RAF later stated it had no record of. Redfern situates the claim within his broader research into alleged "Men in Black" intimidation of UFO witnesses, documented at length in his books The Real Men in Black and Men in Black: Personal Stories & Eerie Adventures.
JH
British UFO Researcher
Scottish-born UFO researcher who served as NICAP's European representative from 1968 and founded the "Euronet" project collecting UFO reports from airline pilots. His 1971 correspondence with Wing Commander Walter Whitworth, RAF West Freugh's former commanding officer, first drew the 1957 radar incident out of official silence and into the published ufological literature.
SC
Science Writer & Skeptical Investigator, Edinburgh
Edinburgh-based architect-turned-science-writer who served as Scottish co-ordinator for a national UFO investigation group and became the prime skeptical investigator of the 1979 Livingston case. In his 1994 book The UFO Mystery Solved, Campbell proposed that Robert Taylor saw a distorted mirage of the planet Venus that triggered a temporal lobe epileptic seizure, and separately suggested mundane apparatus stored in the clearing as the source of the ground marks. The same book applied a related Venus-mirage explanation to the 1952 Nash-Fortenberry sighting. He also authored The Loch Ness Monster: The Evidence and has written for Skeptical Inquirer and The Skeptic.
Founder, Strange Phenomena Investigations (SPI)
Scottish ufologist and founder of Strange Phenomena Investigations who has researched the Livingston case for decades, interviewing Robert Taylor and the investigating officers directly. Author of the 2019 book The Dechmont Woods UFO Incident (An Ordinary Day, An Extraordinary Event), the most detailed single published investigation of the case, and a featured commentator in its 2019 documentary treatment. Robinson has also spent decades investigating the Bonnybridge/Falkirk Triangle wave, co-authoring The Bonnybridge UFO Enigma with Ron Halliday.
Director, Center for UFO Studies (CUFOS)
Used the 1957 Levelland case as a cornerstone example in his 1981 catalog "UFO Reports Involving Vehicle Interference," a 441-report worldwide survey that remains a foundational reference in vehicle-interference research.
CUFOS Levelland
Vehicle-Interference Researcher
Documented how the point-contact distributors and low-voltage ignition and charging systems of 1950s-era vehicles were genuinely susceptible to external electromagnetic field disruption — research cited in analyses of the 1957 Levelland case's engine-and-headlight failure pattern.
Researcher
Published the most exhaustive modern re-investigation of the 1957 Levelland case in 1999–2000, including new interviews with surviving witnesses Newell Wright and A.J. Fowler conducted 42 years after the original events.
NICAP Member, Abilene, Texas
Became the most widely quoted voice advocating an extraterrestrial interpretation of the 1957 Levelland case in the national press, giving the story its first sustained ETH framing even as the Air Force's own investigator was only just arriving in town.
NICAP Levelland
Researcher
Published an extensive 1998 rebuttal in Jerome Clark's The UFO Encyclopedia of Philip Klass's Kessler AFB explanation for the 1957 RB-47 bomber chase, arguing Klass had made a compass-direction error and disputing Kessler's radar operating schedule. Also disputed the weather-balloon explanation proposed for the 1927 Roerich Expedition Sighting, arguing Sven Hedin's small pilot balloons could not plausibly have been visible from the roughly 400 miles separating the two expeditions.
Skeptical Researcher
Countered Brad Sparks on his Bad UFOs blog in 2012, presenting evidence that Kessler Air Force Base's radar training schedule did run overnight classes through the summer of 1957, keeping the ground-radar-reception explanation for the RB-47 case's initial signal technically viable. Also published a technical critique of the 1958 Island of Trindade photographs in his SUNlite bulletin, arguing that computer-enhanced cloud-pattern analysis and wave-timing calculations were inconsistent with photographer Almiro Barauna's stated sequence.
JM
Mexican Journalist and Ufologist; Host, Tercer Milenio
José Jaime Maussan Flota, born May 31, 1953 in Mexico City, studied journalism at UNAM and later at Miami University (Ohio). He began his career covering sports for La Afición in 1970, was recruited as a general-assignment reporter in 1973 by legendary anchor Jacobo Zabludovsky, and by 1984 was a social- and environmental-affairs reporter for Imevisión's newsmagazine 60 Minutos. His pivot to ufology began after a segment he produced on Swiss contactee Billy Meier drew a large audience. On July 18–19, 1991, Maussan aired cameraman Guillermo Arreguín's footage of an object filmed during that month's total solar eclipse, prompting roughly 40,000 viewer calls and more than a dozen additional submitted videotapes — the event that made Maussan Mexico's most prominent UFO investigator and led him to invite viewers with camcorders to form the informal skywatching network "Los Vigilantes del Cielo." He went on to host the long-running program Tercer Milenio. Maussan's credibility is genuinely mixed: independently of the 1991 case, he has promoted multiple claims later shown to be hoaxes, including the 2015 "Roswell Slides" (identified via de-blurring as a 1894 Mesa Verde child mummy display placard), a 2015 "Metepec creature" (identified by UNAM as a shaved monkey), a 2016 "demon fairy" (bat remains, wood, and epoxy), and the September 2023 presentation of alleged "non-human" bodies to the Mexican Congress, which UNAM publicly denied having authenticated and which independent anatomical review concluded were fabricated. Arreguín has for decades disputed Maussan's on-air credit for the 1991 footage, a dispute still unresolved before Mexico's intellectual-property authority as of the 2020s.
JZ
1928 – 2015
Anchor, Televisa's 24 Horas Nightly Newscast
Mexico's most recognized broadcast news anchor for decades, hosting Televisa's flagship nightly newscast 24 Horas and the earlier program Domingo a Domingo, on which a young Jaime Maussan got his start as a general-assignment reporter in 1973. On the evening of July 11, 1991, Zabludovsky's 24 Horas broadcast cameraman Guillermo Arreguín's footage of an unidentified object filmed during that day's total solar eclipse, making it the first television airing of what became one of Mexico's most-discussed UFO cases.
Mexican Skeptical Investigator
A Mexican researcher who conducted one of the most detailed technical re-examinations of the 1991 eclipse videos, using the planetarium program EZCosmos to confirm that the planet Venus was positioned exactly where the luminous object appears in most footage and shone at an unusually bright magnitude of −4.46 that day. Escobar separately found that a subset of the "invisible UFO" photographs — images that appeared to show an object only after film development — were flat, two-dimensional lens-reflection artifacts rather than three-dimensional objects, and publicly criticized Jaime Maussan for promoting the case without first consulting professional astronomers.
BR
1926 – 1997
Italian Egyptologist & Writer
Source of the "translation" of the disputed Tulli Papyrus first published by Tiffany Thayer in 1953. Married Mary de Rachewiltz, daughter of poet Ezra Pound, and later trained formally in Egyptology at the Pontifical Biblical Institute and Cairo University. He consistently maintained he never personally examined the alleged original papyrus, and said in later published letters that Thayer's 1953 printing had altered his account without consent.
Alberto Tulli Tulli Papyrus
TT
1902 – 1959
Novelist; Editor, Doubt Magazine, Fortean Society
Commercially successful pulp novelist who co-founded the Fortean Society in 1931 and, as editor of its magazine Doubt, was the first to put the Tulli Papyrus story into print in 1953. Boris de Rachewiltz later disowned Thayer's printed wording as an unauthorized alteration of what he had actually submitted.
Boris de Rachewiltz Tulli Papyrus
Inspector, Egyptian Section, Vatican Museums (from 1966)
Alberto Tulli's institutional successor at the Vatican Museums. His 1968 cabled statement to Condon Report investigators — that the Tulli Papyrus was never Vatican property and was "dispersed and no more traceable" — remains the single most consequential documentary fact in the case, alongside his private suspicion that Tulli had been deceived by a forger.
Alberto Tulli Tulli Papyrus
Investigator, Condon Report / University of Colorado UFO Project
Commissioned to spot-check ancient UFO claims for the Condon Report, Rosenberg contacted the Vatican Museums directly, obtained Gianfranco Nolli's disavowal of the Tulli Papyrus in writing, and documented extensive structural and linguistic parallels between the papyrus text and the Book of Ezekiel.
Condon Report Tulli Papyrus
Papyrologist, University of Parma
Author of the only dedicated modern academic philological study of the Tulli Papyrus affair (Analecta Papyrologica, 2017), concluding the described text reads as a forgery assembled from fragments of genuine, unrelated Eighteenth Dynasty material rather than a single coherent original composition.
Tulli Papyrus
Ufologist; Editor, Flying Saucer Review
The figure most responsible for moving the disputed Tulli Papyrus from Fortean obscurity into mainstream UFO literature, repeating the claim in three books between 1960 and 1974 without the provenance caveats already raised by skeptics.
Tulli Papyrus
EV
1935 – 2026
Author, Chariots of the Gods? (1968)
Popularized the modern "ancient astronaut" hypothesis to a global mass audience of more than 60 million book sales, folding disputed claims like the Tulli Papyrus and the Sanskrit vimana passages into a broader argument for ancient extraterrestrial visitation. Convicted of fraud and embezzlement in Switzerland in 1970 over falsified business records; his work is near-universally rejected by professional archaeologists and historians as pseudoarchaeology.
Tulli Papyrus Ancient Astronaut Theory
RL
1934 – 2022
Independent Researcher; MUFON/IUFOB Consultant
An electronics technician with a B.A. in Anthropology, not a professional Egyptologist. His self-published English rendering of the disputed Tulli Papyrus text is today the version most commonly reproduced across ufology websites, frequently without indication that it is a non-specialist's rendering of an already twice-removed secondary source.
Tulli Papyrus
Co-author, Wonders in the Sky (2010)
Co-authored, with Jacques Vallée, a systematic sourcebook of historical pre-modern aerial-phenomena reports. The pair examine both the Tulli Papyrus and the 1561 Nuremberg celestial phenomenon, describing the papyrus specifically as a "hoax" given its unverifiable single-viewing transcription chain.
Jacques Vallée Tulli Papyrus
Historian & Researcher
Argues the 1561 Nuremberg broadsheet should be read as popular religiously-themed "tabloid" literature rather than documentary record, pointing to apparent chronological and iconographic inconsistencies in its depiction of Nuremberg's own skyline as evidence publisher Hans Glaser assembled a stock, formulaic composition rather than sketching a personally witnessed event.
Skeptical Researcher & Writer
Published a 2012 sundog/halo-based rebuttal of the extraterrestrial reading of the 1561 Nuremberg celestial phenomenon, and pointed out the irony that Carl Jung introduced the case specifically to argue against a literal ET interpretation, yet later ancient-astronaut writers stripped away Jung's psychological framing and repurposed his work as apparent support for the craft reading.
Art Historian
In her study Nordlichter, argues the 1561 Nuremberg broadsheet functioned as an instrument of ecclesiastical and civic messaging as much as documentation — "popular religiously-themed reading material, more akin to tabloids than to a truthful record of the event."
RC
Active since 1980s
Investigative Journalist & Author
Award-winning Australian investigative journalist (formerly BBC and Channel 7) who broke the David Grusch whistleblower story in June 2023. Author of In Plain Sight and co-host of the podcast Need to Know. One of the leading mainstream media voices investigating UAP crash retrieval claims.
PR
Active since 1970s
UAP Researcher & Author
Independent researcher and writer who co-authored Left at East Gate (1997) with Larry Warren, documenting the Rendlesham Forest incident. He has lectured globally on UAP politics, media coverage, and the history of military disclosure.
PK
1919 – 2005
Skeptic & Senior Editor
An electrical engineer and senior editor for Aviation Week & Space Technology. For decades, he was the world's leading UAP skeptic, attributing most sightings to ball lightning, plasma anomalies, or deliberate hoaxes. Actively investigated the Travis Walton case, arguing it was a financial fabrication. Argued shadow and lighting evidence in the 1950 McMinnville Trent photographs proved they were taken in the morning rather than the evening as claimed, and separately challenged Bruce Maccabee's investigation of the case. Also compared a still photograph of a sun-reflecting aircraft to Nick Mariana's 1950 Great Falls, Montana film to argue for the jet-reflection explanation. Proposed that the 1973 Coyne helicopter incident near Mansfield, Ohio, was an Orionid meteor fireball combined with inadvertent pilot control input, a conclusion CUFOS investigator Jennie Zeidman and others disputed as inconsistent with the case's documented instrument anomalies and multi-witness timeline. His 1983 book UFOs: The Public Deceived separately proposed that the December 1978 Kaikōura lights filmed off New Zealand were misidentified squid-boat fishing fleet lighting. Declared flatly that the Gulf Breeze, Florida Polaroids could not be authentic years before the 1990 model discovery vindicated his position.
SA
Active since 1970
Abduction Researcher & Author
Author of "Out of Time: The Intergenerational Abduction Program Explored." Combining personal experiences of UAP encounters and cattle mutilations in Ireland and Sardinia with extensive analysis, Aspin presents the theory that alien abductions represent an organized, multi-generational program targeting specific family bloodlines.
Abduction Program
PS
Active since 2023
Sociocultural Anthropologist & Sol Foundation Director
Sociocultural anthropologist and Director of the Sol Foundation. He co-founded the Institute for Speculative and Cosmological Inquiry (ISCI). Skafish leads Sol's academic and anthropological research into the cosmological, philosophical, and political implications of UAP disclosure for human society.
Sol Foundation
SR
b. ~1965
UAP Researcher & Documentarian
Lead investigator of the Westall UFO encounter who spent years locating and interviewing over 100 original student and teacher witnesses, reconstructing the timeline and official cover-up.
JV
Astronomer, Computer Scientist & UAP Theorist
One of the world's most prominent UAP researchers, and a protégé of J. Allen Hynek, who co-developed the "interdimensional hypothesis" (IDH) — that UAP may originate from parallel realities rather than distant planets. Author of Passport to Magonia, Dimensions, and Trinity. Analyzed isotopic ratios of anomalous materials at Stanford, served as a consultant to AATIP, and served as the inspiration for the character Lacombe in Close Encounters of the Third Kind. One of the most intellectually rigorous researchers in the field.
J. Allen Hynek AATIP Stanford Interdimensional Hypothesis Bismuth-Magnesium Petrozavodsk Phenomenon Lake Cote UFO Photograph Araçariguama Sighting
RV
1950–2021
Costa Rican UFO Researcher
Alongside his brother Carlos Vílchez Navamuel, one of Costa Rica's most prominent UFO researchers from the 1970s through the 2000s. Vílchez obtained a copy of the Lake Cote UFO photograph's negative later in the 1970s and, in 1979, submitted it to the U.S. group Ground Saucer Watch for computer-enhancement analysis. In 1985, he personally related the photograph's story and provided a further negative copy to visiting researcher Jacques Vallée — the step that led directly to the 1989 and 1990 Haines & Vallée papers in the Journal of Scientific Exploration. He and Carlos also documented the case of Costa Rican contactee Enrique Castillo Rincón and published several books on Costa Rican ufology. Vílchez died of COVID-19 complications on November 4, 2021, at age 71.
Costa Rican Attorney & UAP Researcher
A Costa Rican attorney and custodian of an 8x10 contact copy of the Lake Cote UFO photograph's negative, inherited from his uncle, who had obtained it from the Instituto Geográfico Nacional in the late 1970s or early 1980s. In 2022, Carranza arranged for the image to be professionally drum-scanned by Michael Strickland Photography in Kansas and released the resulting high-resolution file through the UK-based research outlet UAP Media, reigniting international interest in the case — a scan whose authenticity as an unaltered digitization has since drawn separate, unresolved technical scrutiny from independent reviewers.
DC
Journalist & Associate Professor
Investigative journalist and academic who tracked down Craig Lindsay, recovered the original Calvine photograph, and collaborated with Sheffield Hallam University to analyze and verify the image. Has worked extensively with the National Archives on declassified MoD UFO files, including the 1974 Berwyn Mountains case and the 1957 West Freugh radar incident (which he ranks among his personal "Top 10 UFO documents" at the National Archives), and co-authored The UFOs That Never Were (2000) and Out of the Shadows (2002) with Andy Roberts. His own 30th-anniversary re-investigation of the March 1993 Cosford Incident, drawing on a fresh interview with witness Wayne Elliott and the declassified MoD files, remains the most detailed independent account of how the flap's two most famous sightings were resolved. Also independently analyzed a declassified 1969 U.S. Army daily journal entry describing an egg-shaped object at Chu Lai, South Vietnam, shortly after its 2011 discovery by National Archives archivist Joe Gillette, weighing it against ball-lightning and "spook light" explanations. In a June 25, 2008 wire-service interview given during his tenure as the MoD UFO files project's media consultant, Clarke offered the leading skeptical explanation for the St Athan police helicopter sighting, noting that a helicopter pilot seeing brightly lit Chinese sky lanterns at night "could easily think he was looking at another aircraft."
JF
Active since 1973
Historian; Founder, CEAFI/CNIFO; Professor, Universidade Fernando Pessoa
Portuguese historian who founded CEAFI (Centro de Estudos Astronômicos e de Fenómenos Insólitos) in 1973 during what Portuguese ufological literature calls the "golden age" of organized UFO research in the country, and later led its restructured successor, CNIFO (Comissão Nacional de Investigação do Fenómeno OVNI). As Air Force Chief of Staff, General José Lemos Ferreira authorized CNIFO's access to Air Force data and to Ota Air Base itself for a 1983–1984 multidisciplinary investigation involving roughly thirty consulting scientists, most concretely documented in connection with the separate November 2, 1982 Ota-area sighting but repeatedly framed by Fernandes's own writing alongside Ferreira's own 1957 encounter as the two flagship military-pilot UFO cases in the Portuguese record. When CNIFO dissolved in the mid-1990s, its archive of several hundred documented Portuguese cases passed to CTEC (Centro Transdisciplinar de Estudos da Consciência) at Universidade Fernando Pessoa, where Fernandes continued his academic career.
Former Astronomical Consultant, British UFO Research Association (BUFORA)
Filed the September 2005 Freedom of Information Act request for Project Condign jointly with David Clarke, contributing his own background in astronomical misidentification analysis to the pair's subsequent examination of the Ministry of Defence's redacted 2006 release. Also obtained the NASA/US Space Command trajectory simulation that identified the Cosmos 2238 rocket booster's atmospheric re-entry as the source of the main cluster of sightings in the March 1993 Cosford Incident.
Assistant Editor, Grimsby Evening Telegraph
Published "The Riddle of Foxtrot 94" in October 1992, introducing the UFO narrative around Captain William Schaffner's 1970 disappearance for the first time, twenty-two years after the event, based on a single anonymous phone call from a man claiming to have served on the RAF's original crash investigation team. Otter has since acknowledged he found the caller's account "far-fetched" but published it regardless; no named source, radar log, or corroborating witness has ever substantiated the story, which directly contradicts the authenticated transcript declassified by the Ministry of Defence in 2003.
Grimsby Evening Telegraph Captain William Schaffner Incident
AR
Senior Lecturer in Photography
Photography academic who conducted a detailed forensic analysis of the Calvine print, concluding there was no evidence of darkroom manipulation, double exposure, or negative editing.
Sheffield Hallam Calvine UFO Incident
JM
UAP Researcher & Journalist, Puerto Rico
Prominent Puerto Rican investigative journalist and editor of Evidencia Ovni, who thoroughly documented and analyzed the Amaury Rivera abduction and jet pursuit photographs. Martín was also the first to publish the leaked 2013 Aguadilla CBP infrared video, having received it from a source inside Rafael Hernández Airport security and running it in his own ENIGMAS del Milenio magazine.
WS
1923 – 2010
USAF Lieutenant Colonel (Ret.); UAP Investigator
One of the most active investigators of global UAP cases. Translated and published Stefan Denaerde's account of the Iarga encounter and thoroughly investigated Puerto Rican sightings.
DE
1930 – 1984
Physics Professor & UAP Investigator
Former university physics professor, airline pilot, and founder of L/L Research who co-investigated the Lee Parrish abduction and conducted regression hypnosis sessions.
L/L Research Prospect Abduction
CR
1943 – 2015
Co-Founder of L/L Research & Hypnotist
Author and researcher who assisted in the investigation of the Lee Parrish abduction, documenting the psychological effects and transcriptions of regression hypnosis.
L/L Research Prospect Abduction
BG
Active 1950s–2000s
Balloon Engineer, Skyhook Program Veteran
Engineer with more than three decades of hands-on experience in Skyhook-era high-altitude balloon operations. His detailed 2004 Skeptical Inquirer article, "The Cold War's Classified Skyhook Program," remains the most technically thorough defense of the balloon explanation for the Mantell case, while candidly acknowledging the specific flight was never conclusively logged.
Thomas Mantell Crash Skyhook Program
GA
1891 – 1965
Contactee & Author
One of the earliest and most famous UFO "contactees," claiming personal contact with Venusian visitors beginning in 1952. In connection with the Mantell case, Adamski claimed — without evidence — that Mantell's aircraft had been torn apart by the object's own power field, one of the most sensationalized claims later debunked by Air Force investigators and Edward Ruppelt.
JC
UFO Historian & Author, The UFO Encyclopedia
Prominent UFO historian whose multi-edition UFO Encyclopedia is one of the field's standard reference works. On the 1948 Gorman Dogfight, Clark judged the Air Force's weather-balloon explanation "seems plausible" while calling the case, after Mantell, "the most overrated UFO report in the early history of the phenomenon" — a notable assessment from within the UFO research community rather than from an outside skeptic. In 1977, Clark investigated and corroborated an elderly Kansas woman's claim that rancher Alexander Hamilton's famous 1897 "cattle lasso" airship story had been invented to win a local "liars' club" tall-tale contest, establishing it as the best-documented confirmed hoax within the wider 1896-97 mystery airship wave.
TZ
20th century
FOIA Researcher; Co-Founder, Citizens Against UFO Secrecy (CAUS)
Former Army Security Agency and NSA communications specialist with Top Secret clearance who became a prominent UFO researcher in 1976 as National Director of Research for Ground Saucer Watch. In September 1977, working with attorney Peter Gersten, Zechel filed a Freedom of Information Act lawsuit against the CIA that in 1979 forced the agency to release or acknowledge thousands of documents it had previously claimed did not exist — reported at the time by The Washington Post and outlets nationwide. In 1978 he co-founded Citizens Against UFO Secrecy (CAUS) and edited its newsletter, Just Cause. Zechel later claimed the July 1951 White Sands film and two earlier White Sands cinetheodolite films had been quietly routed to the CIA's Office of Scientific Intelligence — an allegation not corroborated by the CIA's own subsequent declassified history of its UFO-related activities.
PG
20th century
Attorney, UFO Disclosure Litigation
New York attorney who, working with researcher Todd Zechel and the group Ground Saucer Watch, filed a September 1977 Freedom of Information Act lawsuit against the CIA that in 1979 forced the agency to release or acknowledge thousands of UFO-related documents it had previously claimed did not exist. Gersten went on to become one of the best-known attorneys pursuing UFO-related FOIA and disclosure litigation in the following decades.
JH
fl. 1951
Editor, Lubbock Avalanche-Journal
Purchased Carl Hart Jr.'s five Lubbock Lights photographs for $10 in early September 1951, reportedly warning Hart he would "run him out of town" if the images proved fraudulent. His newspaper's front-page publication of the photographs set off their rapid national syndication, culminating in Life magazine's April 1952 feature.
MH
fl. 1990s–2000s
UFO Researcher & Author
Co-author, with Wendy Connors, of a detailed documentary history of the Lubbock Lights case drawing on Edward Ruppelt's private papers and Project Blue Book files, and co-author of Captain Edward J. Ruppelt: Summer of the Saucers — 1952, which documents Blue Book's investigation of the July 24, 1952 Carson Sink Incident alongside the rest of that summer's flap. Hall separately discussed Carson Sink in his own UFOs: A Century of Sightings (2000). His and Connors's account is among the most thorough independent reconstructions of the Lubbock case's investigation and aftermath, including Professor W.L. Ducker's later private research.
DB
Mathematician & UFO Researcher
Published "New Findings on the Lubbock Lights" in the International UFO Reporter in 2001, after roughly two years of computer image-enhancement work on one of Carl Hart Jr.'s surviving negatives, reporting a previously undocumented hexagonal cellular pattern on one photographed object. His analysis remains the most significant modern technical re-examination of the photographs, though it has not been independently replicated.
RS
Skeptic, Writer & Founding Member, CSICOP / CSI UFO Subcommittee
A freelance writer who authored the "Psychic Vibrations" column for Skeptical Inquirer from 1977 to 2017 and maintains The Debunker's Domain (debunker.com) and the Bad UFOs blog. His books The UFO Verdict (1981) and UFO Sightings: The Evidence (1998) group the Mariana film among the classic-era "best" UFO photographic and film cases he argues do not withstand close technical scrutiny, applying the same aircraft-reflection framework the Air Force used in 1950 and 1953. He has separately applied shadow-geometry analysis to the McMinnville Trent photographs. As a founding member of the UFO Subcommittee of the Committee for Skeptical Inquiry (formerly CSICOP) and author of Bad UFOs: Critical Thinking About UFO Claims, his observation that aircraft punching through cloud layers typically leave turbulent rather than crisp, disc-shaped holes has been cited in skeptical analyses of the 2006 Chicago O'Hare sighting's hole-punch-cloud explanation. His July–August 1977 Humanist article first identified the planet Venus as the likely source of the Jimmy Carter UFO sighting, and his Bad UFOs blog later published atmospheric scientist Carl Justus's competing Eglin AFB barium-cloud identification for the same case. His 1991 Skeptical Inquirer "Psychic Vibrations" column tracked the unraveling of the Gulf Breeze, Florida photo case, and Bad UFOs devotes a chapter to Ed Walters's Polaroids.
BC
1906 – 1975
Nationally Syndicated Journalist & Columnist
A prolific Hearst/International News Service columnist and co-author of Thirty Seconds Over Tokyo and The Babe Ruth Story, Considine wrote "The Disgraceful Flying Saucer Hoax" for Cosmopolitan in January 1951, debunking the most prominent early UFO cases including Nick Mariana's film. Mariana sued him for slander over the piece, arguing it painted him as "a liar, prankster, half-wit, crank, publicity hound and fanatic"; the suit was dropped in September 1955.
AH
fl. 1970s
Chief Investigator, Center for UFO Studies (CUFOS)
Personally investigated more than a thousand UFO reports as CUFOS's principal field investigator through most of the 1970s, publishing his methodology and findings in the 1979 book The UFO Handbook. His statistical analysis established bright fireball meteors as one of the single most common sources of high-quality "structured craft" reports — the same misperception dynamic later researchers applied retroactively to the 1948 Chiles-Whitted sighting.
JZ
1932 – 2020
Field Investigator, Center for UFO Studies (CUFOS); former Project Blue Book staff assistant
A former Ohio State University astronomy student who served as J. Allen Hynek's first secretary and research assistant during the early years of Project Blue Book, Zeidman went on to become one of CUFOS's most methodical field investigators. Her defining work was the exhaustive, independent investigation of the October 1973 Coyne helicopter incident near Mansfield, Ohio — more than 18 hours of crew interviews plus direct interviews with corroborating ground witnesses, published as the March 1979 CUFOS monograph A Helicopter-UFO Encounter over Ohio. She also authored "The Lumberton Report" (1976) on a North Carolina UFO wave, and remained active in UFO research for nearly seven decades.
TP
Physical-Trace Investigator, APRO / Center for UFO Studies (CUFOS)
One of ufology's foremost specialists in physical ground-trace evidence, built on the conviction that eyewitness testimony alone could never resolve the UFO question without accompanying physical proof. Phillips made his first visit to the Delphos, Kansas ring site on December 4, 1971, thirty-two days after the sighting, documenting the ring's persistence and water-repellent surface, and continued tracking the case for over a decade, publishing further findings in the MUFON UFO Journal in 1985. His 1975 CUFOS-published catalog, Physical Traces Associated with UFO Sightings, helped establish ground-trace documentation as a distinct methodology within UFO field investigation and formally catalogued the 1966 Tully, Queensland saucer nest as one of its earliest non-American entries.
JF
1913 – 1990
Author & Journalist, Saturday Review Columnist
A widely read Saturday Review "Trade Winds" columnist with no prior background in UFO research, Fuller arrived in Exeter, New Hampshire in the fall of 1965 already skeptical of the subject, and grew steadily less so over roughly sixty witness interviews. His resulting book, Incident at Exeter (1966), became a New York Times bestseller and ran through at least six printings, reframing the case for a national audience around the credibility of its two police-officer witnesses. Fuller wrote the era's other landmark New Hampshire UFO book, The Interrupted Journey (1966), on the Betty and Barney Hill case, and his sustained press profile helped feed the climate that produced Congress's first public UFO hearing in April 1966.
RF
1933 – 2018
Chairman, Massachusetts Subcommittee, National Investigations Committee on Aerial Phenomena (NICAP)
Traveled to Exeter, New Hampshire on September 11, 1965, just over a week after the sighting, to conduct an independent NICAP field investigation separate from the Air Force's own inquiry. His detailed written report was subsequently entered into the Congressional Record in connection with the House Armed Services Committee's April 5, 1966 UFO hearing, the first Congress ever held on the subject. Fowler went on to become one of NICAP's most prolific field investigators, authoring several books on the Betty Andreasson case, and later led the multi-year investigation into the 1976 Allagash Waterway Abduction, directing separate hypnotic regression sessions with all four witnesses and publishing his findings as The Allagash Abductions (1993).
GH
21st century
Researcher, UFOBC.ca
Conducted a multi-year investigation of the Kinross Incident, published in the UFOBC Quarterly Magazine in 2003, and personally located and interviewed retired RCAF pilot Gerald Fosberg in 2004, obtaining Fosberg's on-record denial that he was ever off course the night of the disappearance.
JC
21st century
International Director, Mutual UFO Network (MUFON)
As MUFON's International Director in 2006, led the investigation that conclusively established the "Great Lakes Dive Company" claim of having located F-89 Scorpion wreckage in Lake Superior was a hoax — finding no registered company by that name, a fabricated Associated Press story, and sonar imagery that could not have been produced by the equipment claimed. Separately led MUFON's 2007–2008 field investigation of Chris Bledsoe's Cape Fear River encounter, overseeing its hypnosis, polygraph, and psychological-evaluation components.
BB
21st century
Great Lakes Maritime Historian
A Great Lakes shipwreck historian whose independent research corroborated James Carrion's 2006 finding that no legitimate dive operation matching the "Great Lakes Dive Company" description existed, helping expose that year's F-89 wreckage claim as fabricated.
FR
21st century
NICAP Web Archivist
Longtime NICAP web archivist who received and initially circulated the September 2006 email from "Adam Jimenez" claiming discovery of the missing Kinross F-89's wreckage, and whose subsequent research collaboration with James Carrion and Brendon Baillod helped expose the claim as a hoax.
FW
21st century
UFO Researcher & Blogger, The UFO Chronicles
UFO researcher and blogger who published a detailed contemporaneous account of the 2006 "Great Lakes Dive Company" wreckage claim, summarizing the investigation that exposed it: "The Great Lakes Dive Company debacle was a hoax created out of whole cloth."
JT
21st century
Paranormal Investigator & Radio Host
Paranormal investigator who has relayed an uncorroborated secondhand claim that a witness present the night of the Kinross Incident described hearing Moncla's voice over the radio hours after official contact was lost — an account absent from the contemporaneous 1953 record and treated by this site as unverified.
NC
1911 – 1993
Anglican Missionary & Amateur Naturalist, Menapi Mission, Papua
An English-born Anglican missionary and priest-botanist stationed at Menapi in the Territory of Papua, and a personal friend of Rev. William Gill. After his own UFO sighting, Cruttwell began systematically collecting Papuan reports and became Flying Saucer Review's Papuan investigator, ultimately compiling a 45-page March 1960 report, "Flying Saucers Over Papua," documenting 79 regional sightings — 60 of them clustered around Boianai — the first systematic outside investigation of the Gill case.
BC
Australian Scientist & UFO Researcher
A chemist and one of Australia's most prominent UFO researchers, and the first outside investigator ever granted access to the Royal Australian Air Force's classified UFO files. Interviewed Rev. William Gill directly in 1978 and corresponded with him for years afterward, uncovering Gill's private, unpublicized theological speculation that the Boianai figures might have been angels rather than extraterrestrial visitors. Also conducted a detailed 1981 re-interview of George Pedley on the 1966 Tully saucer nest case. Author of The Oz Files: The Australian UFO Story (1996).
DH
Professor Emeritus of Religious Studies, University of North Carolina at Chapel Hill
A scholar of religion whose research reframes UFO encounters as a modern form of visionary religious experience. In "Anatomy of a Vision: A Psychological Approach to the Papua New Guinea UFO Sightings, June 26-27th, 1959," presented to the International Association for Jungian Studies, he argues the Boianai sightings are best understood as a collective vision shaped by bright planets glimpsed through moving cloud and by the religious expectancy of a mission community with deep roots in the region's cargo-cult tradition, rather than as either a hoax or a literal spacecraft.
RS
UFO Researcher & Encyclopedia Editor
Founder of the original UFO Encyclopedia Project and editor of The Encyclopedia of UFOs (1980). In a 1979 survey of ninety leading ufologists asking for the single strongest piece of UFO evidence available, Story found the Father Gill case at Boianai cited more often than any other, cementing its reputation as one of the field's most persuasive multi-witness reports.
Transportation Reporter, Chicago Tribune
Longtime Chicago Tribune transportation reporter whose January 1, 2007 front-page investigation, "In the sky! A bird? A plane? A … UFO?", broke the O'Hare International Airport UFO sighting to a national audience two months after the event. Built on interviews with numerous United Airlines witnesses and a Freedom of Information Act request that forced the FAA to acknowledge a supervisor's real-time tower call, the story drew over a million page views in its first week, becoming the most-read story in the newspaper's website history at the time.
PD
Director since 1994
Director, National UFO Reporting Center (NUFORC)
Director of the National UFO Reporting Center (NUFORC) since 1994, overseeing the organization's public sighting-report database. After NUFORC received scattered independent civilian reports describing an object over the O'Hare International Airport area in the weeks following November 7, 2006, Davenport contacted Jon Hilkevitch of the Chicago Tribune directly on December 16, 2006, setting in motion the investigation that broke the case publicly the following January.
Host, Skeptoid Podcast
Science writer and host of the long-running Skeptoid podcast, known for detailed skeptical investigations of popular paranormal and UFO claims. His March 2024 episode on the O'Hare sighting (#926) argued the case likely reflects a combination of an unphotographed conventional event and memory-conformity effects among witnesses not formally interviewed until roughly two months after the fact. His episode #853, "Brazil's Roswell: The Varginha UFO," similarly argues the 1996 Varginha case reflects mundane events — including an ordinary post-surgical infection death and a documented local misidentification — magnified by decades of media amplification.
RG
Founded NUFORC 1974
Founder, National UFO Reporting Center (NUFORC)
A Seattle firefighter who founded the National UFO Reporting Center (NUFORC) in 1974 as a civilian clearinghouse for sighting reports, filling a gap left by Project Blue Book's 1969 closure. The organization he founded, later directed by Peter Davenport, was the channel through which independent witness reports of the November 2006 O'Hare International Airport sighting first reached a journalist.
Reporter & Filmmaker, New York Post / "The Basement Office"
New York Post reporter and freelance filmmaker who hosts the video series "The Basement Office." In 2021, Greenstreet filed a fresh Freedom of Information Act request that recovered additional FAA tower audio related to the November 2006 O'Hare International Airport sighting, years after the case's original 2007 exposure.
MUFON Director of Research (2007–2017); Co-Founder, Scientific Coalition for UAP Studies
A chemist with a semiconductor-engineering background at Advanced Micro Devices, Powell led MUFON's national research effort and co-authored, with Glen Schulze, the July 2008 "Stephenville Lights: A Comprehensive Radar and Witness Report Study," built from roughly 2.8 million FOIA-obtained FAA and National Weather Service radar returns. Powell later co-founded the Scientific Coalition for UAP Studies (SCU) and authored UFOs: A Scientist Explains What We Know (And Don't Know) (2024). In 2022, he led the SCU/CUFOS team that published the first modern HR-ICPMS isotope re-analysis of the Ubatuba magnesium fragments in the Journal of Scientific Exploration. SCU's roughly two-year, 1,000-plus man-hour investigation of the 2013 Aguadilla CBP infrared video, published in 2015 under Powell's direction, remains the most detailed independent technical counter-analysis to AARO's 2025 sky-lantern case resolution.
Radar Analyst; Co-Author, MUFON Stephenville Radar Report
A radar analyst with operational experience at White Sands Missile Range, Schulze partnered with Robert Powell to file the Freedom of Information Act requests and analyze the roughly 2.8 million raw radar returns underlying MUFON's 2008 Stephenville Lights report. Schulze publicly stated he was "convinced that there were objects in the air that night that were not traveling with beacons on, that the military is not claiming and that the FAA is not explaining."
MUFON Texas State Director
A fifth-generation Texan and U.S. Marine Corps veteran who supervised roughly 41 certified MUFON investigators statewide, Cherry led the on-the-ground witness investigation into the January 2008 Stephenville Lights sightings, organizing the collection of over 50 reports. He publicly acknowledged that a meaningful share of the wider report pool likely reflected "mass hysteria," and later authored Marc Slade Investigates: The Stephenville UFO (2016).
Astronomer & Director, Grasslands Observatory; Retired U.S. Air Force Pilot
A retired U.S. Air Force pilot who once held a Top Secret security clearance for classified operations, McGaha is an astronomer and director of the Grasslands Observatory in Tucson and a longtime scientific consultant to the Committee for Skeptical Inquiry. With Joe Nickell, he published "The Stephenville Lights: What Actually Happened" (Skeptical Inquirer, 2009), directly contacting the 301st Fighter Wing to confirm its January 23, 2008 reversal and critiquing MUFON's radar analysis as drawn from a small, "cherry-picked" subset of the full data set. McGaha also investigated the 1997 Phoenix Lights and grouped both cases in a 2015 retrospective.
Reporter, Stephenville Empire-Tribune (1961–2021)
The local Stephenville, Texas journalist who broke the January 2008 UFO sightings story in the pages of the Empire-Tribune, treating witness accounts with a straightforward, factual style. Her coverage drew international attention, two appearances on Larry King Live, and UFO Digest's 2009 "UFO Reporter of the Year" award. Joiner died in Stephenville on January 7, 2021.
Founder, Welsh Fellowship of Independent Ufologists
Retired ufologist who, in July 1991, tracked down and reinterviewed nurse Pat Evans about the January 1974 Berwyn Mountains earthquake-night lights, seventeen years after the event. Fry's research, fed into BUFORA's network and Jenny Randles's writing, is largely responsible for reintroducing the case to a national ufological audience during the 1990s.
Investigator, Conway UFO Group
Investigator who worked alongside Margaret Fry from the late 1990s researching the Berwyn Mountains case, and who has specifically disputed the "poachers'-lamps" component of the skeptical explanation for some of the case's peripheral, multi-night light reports on timing and geography grounds.
Author, Flight 7 Is Missing: The Search for My Father
The son of William H. Fortenberry, who was six years old when his father was lost aboard Pan Am Flight 7 in November 1957. Ken Fortenberry spent much of his adult life investigating the crash, publishing a book on the subject in 2020 and discussing both the 1957 loss and his father's 1952 UFO sighting on the Podcast UFO program that June, reviving public attention to both stories for a new generation.
Civilian Investigator; Akron UFO Research Committee
Ran a small civilian research organization out of Akron, Ohio, and personally gathered statements from both the roughly dozen local ground witnesses and the corroborating American and United Airlines flight crews following the February 24, 1959 Killian sighting, compiling them into a report later reproduced in full within the Project Blue Book case file.
AC
Investigator; Vice President, CUN (1979); First President, CISU
A mathematics and business economics teacher from Benevento who became one of Italy's most prominent investigative ufologists, Chiumiento was vice president of the Centro Ufologico Nazionale when he interviewed Giancarlo Cecconi directly within months of the June 1979 Treviso sighting. He spent five years pressing the Italian Ministry of Defense for an official response, published the case's first English-language account in Flying Saucer Review in 1988, and later became CISU's first president. Discussed the case again among roughly eighty-five career investigations in his 2020 book Obiettivo non identificato.
Coordinator, CISU Project AIRCAT (Bologna)
Coordinated CISU's Project AIRCAT, a dedicated research initiative focused on pilot, radar, and military-aircraft UFO reports, which selected the Treviso case as one of its first investigations in September 1994. Conducted fresh interviews with Giancarlo Cecconi fifteen years after the sighting, confirmed the three photographs published by Epoca magazine genuinely belonged to Cecconi's original series, and published the most detailed reconstruction of the case in issue 17 of UFO Magazine in 1996.
Reporter, Channel 0, Melbourne (later Network Ten)
Dispatched to New Zealand to film routine background footage on the December 21, 1978 Kaikōura sightings, Fogarty instead narrated the December 30–31 encounter live on tape aboard a Safe Air Argosy, delivering the case's best-known line, "let's hope they're friendly," and later publishing the 1982 first-person account of the same title.
Cameraman, Channel 0, Melbourne
Filmed roughly fourteen minutes of 16mm colour footage of the unidentified lights during the December 30–31, 1978 Kaikōura flight while monitoring pilot commentary and Wellington radar traffic through his headset, working alongside his wife and sound recordist, Ngaire Crockett. His footage was subsequently analysed by physicist Bruce Maccabee and, two decades later, reassessed by skeptic William Ireland; Crockett later produced his own documentary treatment and gave public lectures on the case.
VD
fl. 1986 – 1995
Head, Far Eastern Committee for Anomalous Atmospheric Phenomena
Primary field investigator of the January 29, 1986 Dalnegorsk Height 611 Crash, arriving at the site within days of the event and leading the first expedition to collect metallic mesh fragments, glassy beads, and scorched rock and vegetation samples. Russian-language sources describe him variously as a biologist and a "Doctor of Sciences," a genuine ambiguity this file notes honestly rather than resolves; what is well documented is that he arranged for the recovered material to be distributed to roughly eleven Soviet research institutes and three academic centers for independent analysis, rather than relying solely on his own field assessment. He concluded the object was most likely a malfunctioning space probe of non-terrestrial origin, became a dedicated ufologist afterward, published a newsletter titled Vysota 611 ("Height 611"), and presented his findings at the International UFO Congress in California in 1995. Even researchers skeptical of his ultimate conclusion have credited him for grounding the investigation in laboratory analysis rather than testimony alone.
GB
Russian Ufologist & Researcher
Published a 1993 alternative analysis of the Dalnegorsk Height 611 Crash arguing the object was more likely a classified Soviet-built remotely piloted probe than an extraterrestrial craft, noting that the lead recovered at the site could be traced to the real, known Kholodninskoye ore deposit in the northern Baikal region rather than to anything of unidentified origin. His theory sits alongside a parallel proposal from aircraft-crash journalist V. Psalomschikov that the debris matched 1970s-era Soviet aerospace hardware, forming the core of the "secret military technology" reading of the case that this file weighs against Valeri Dvuzhilny's non-terrestrial interpretation.
AM
Aviation Engineer & Amateur Ufologist; Author of the Original "Kommuna" Article
An aviation engineer and self-described amateur ufologist, not a professional journalist, who wrote "Football with Aliens" ("Футбол с пришельцами"), the October 3, 1989 article in the Voronezh Communist Party newspaper Kommuna that first brought the schoolchildren's reports of the Voronezh Landing to public attention and triggered the chain of events leading to TASS's global wire report six days later. Mosolov's article was assembled from interviews with the children themselves, without independent adult corroboration and without the kind of editorial fact-checking a professional newsroom would normally apply to an extraordinary claim; retrospective Russian-language reporting on the case has specifically noted that Mosolov's dual role as both an enthusiastic believer in the phenomenon and the story's original reporter is a significant, often-overlooked factor in how quickly an initially thin, child-sourced account escalated into an internationally reported "landing."
VP
Soviet Television Journalist & Correspondent
A prominent Soviet (and later international) television journalist and commentator, widely known in the West through his joint US–USSR "space bridge" satellite broadcasts with Phil Donahue during the late 1980s. Posner dispatched his own film crew to Voronezh to independently assess the landing reports as they gained international traction in October 1989. According to skeptical investigator Paul Kurtz's contemporaneous account in Skeptical Inquirer, Posner's crew was unable to locate any credible witnesses beyond the original group of children, leading Posner to conclude publicly that "the creative imagination of young children was perhaps at work" — one of the earliest and most prominent Soviet media figures to push back on the sensationalized coverage his own profession had helped generate.
Spanish UFO Researcher; Curator, FOTOCAT Database
A Spanish researcher active since the 1960s who evolved from an early believer in extraterrestrial visitation into one of European ufology's most prominent scientific-oriented, evidence-based investigators. His March 1991 report to the Spanish Air Force General Staff, documenting how other NATO nations had already declassified their UFO archives, directly led to the 1992–1999 phased release of 84 Spanish Air Force case files — including the Manises UFO Emergency Landing file — making Spain one of the earliest NATO countries to open its military UFO archive to public review. He later wrote the prologue to Juan Antonio Fernández Peris's Escombreras analysis of the case. In March 1994, corresponding independently with the MoD's Nick Pope about the March 1993 Cosford Incident, he supplied a NORAD trajectory statement and computer simulation confirming the Cosmos 2238 rocket-body re-entry as the source of the wave's main sighting cluster. In 1999, he obtained declassified U.S. Navy Eastern Test Range Poseidon C-3 missile-launch records and, with Ricardo Campo Pérez, published the March 2001 identification of the 1974–1979 Gando Air Base / Canary Islands UFO sighting cluster as Poseidon missile tests in the Spanish Air Force's own official journal. In 2020, with three co-authors, published a six-year reanalysis of the 1965 Deception Island Sightings, concluding several of the wave's Antarctic sightings are consistent with the Echo II satellite and misidentified stars.
Engineer & Researcher
Author of the ~200-page study El Expediente Manises (2000), the most detailed independent analysis of the declassified Spanish Air Force file on the Manises UFO Emergency Landing. Proposed that flares from the Escombreras petrochemical complex near Cartagena, magnified by a strong thermal inversion and combined with misidentified stars and planets, explained the sightings — an explanation both principal pilot witnesses rejected and that researcher Miguel Ángel Ruiz later disputed on geometric and evidentiary grounds. The work won the Fundación Anomalía's Premio Ricardo Caruncho.
Investigator, Oficina de Investigación de Fenómenos Aéreos Anómalos (OIFAA/DIFAA), Peru
A Peruvian lawyer and UAP researcher who worked with the Peruvian Air Force's official anomalous-phenomena investigation office (OIFAA, later DIFAA), founded in December 2001. Compiled a report exceeding 100 pages on the La Joya Air Base Incident, conducted decades after the 1980 encounter itself and remaining one of the most complete standalone investigative files on the case.
RG
Researcher & Writer, LIFE Magazine
Began Pentagon interviews on February 25, 1952 that led to LIFE's widely-read April 7, 1952 article "Have We Visitors From Space?", co-written with H.B. Darrach Jr., which listed the January 29, 1952 Wonsan-Sunchon UFO Incident among the ten cases its authors judged most credible and reached more than 350 newspapers in excerpt. Later became a founding editor of People magazine and Editor-in-Chief of Little, Brown Publishing.
TK
1945 – 2009
Founding Chairman, Finnish UFO Researchers Association (Suomen Ufotutkijat ry); Editor-in-Chief, Ultra magazine
A founding member and longtime chairman of Finland's principal UFO research organization and managing director of its publisher, Kustannus Oy Rajatieto, Kuningas was among the first researchers to formally document the Seven Balloons of Pori incident, including it in his 1970 survey Ufoja Suomen taivaalla ("UFOs in Finland's Sky") within a year of the sighting, and discussed the case again on Finnish public broadcaster Yle's 1982 radio documentary series Mystillistä. That same 1970 book gave the Imjärvi Incident its own earliest documentary treatment, within the same calendar year as the encounter itself.
PC
Active 1990s–present
Author & Professional Engineer, Canadian Department of National Defence
A DND engineer and NATO electromagnetics representative who also authored Storms of Controversy: The Secret Avro Arrow Files Revealed, Campagna obtained a "Secret"-marked file in 1995, declassified under Canada's Access to Information framework, containing the 22nd NORAD Region's own Air Traffic Control Log Book covering the November 1975 CFS Falconbridge incident. He published its contents and his own analysis as Chapter Nine of The UFO Files: The Canadian Connection Exposed (1997), concluding that contemporary press coverage of the case had been "essentially correct."
CR
Active 1970s–present
UFO Researcher, Science Writer & Author
Canada's most prominent civilian UFO researcher, publisher of the annual Canadian UFO Survey and author of The Canadian UFO Report. Began cataloguing Canadian sightings as an undergraduate during the 1975 Charlie Redstar wave centered on Carman, Manitoba, his home province, later documenting more than 2,000 pages of that year's National Research Council case files and revisiting the case directly in his own 1993 book chapter "Charlie Redstar and Friends" — the broader Canadian reporting climate the November 1975 CFS Falconbridge incident also occurred within.
Authors & FOIA Researchers, Clear Intent (1984)
Co-authors of Clear Intent: The Government Coverup of the UFO Experience, which used Freedom of Information Act requests to document the October–November 1975 wave of unidentified intrusions at Loring, Wurtsmith, Malmstrom, and Minot Air Force Bases, including a CINCNORAD message dated November 11, 1975 that named Canadian Forces Station Falconbridge alongside those bases as the wave's Canadian entry.
GB
Commander, U.S. Seventh Air Force (1968–1970); Chairman, Joint Chiefs of Staff (1974–1978)
As commander of Seventh Air Force during the period covered by the HMAS Hobart / DMZ Vietnam Incident, Brown later referenced the episode publicly at an October 1973 press conference amid that year's U.S. UFO wave, stating the DMZ contacts "weren't called UFOs. They were called enemy helicopters," and describing the "quite a battle" that resulted in an Australian destroyer "taking a hit." His statement became the central piece of evidence Lawrence Fawcett and Barry Greenwood's Clear Intent used to bring the case into the wider UFO literature, even though Brown's own words explicitly deny the extraterrestrial framing.
KS
Active 1960s–1970s
Commanding Officer, HMAS Hobart, 22 Mar – 11 Oct 1968
Commanded the guided-missile destroyer HMAS Hobart throughout her second Vietnam deployment, including the early hours of 17 June 1968, when a USAF F-4 Phantom mistakenly struck the ship with three air-to-air missiles off Tiger Island. See the HMAS Hobart / DMZ Vietnam Incident case file.
IN
Commander, Israeli Air Force, 2008–2012
Commander, Israeli Air Force
As commander of the Israeli Air Force, ordered the 16 December 2010 F-16 intercept that destroyed an unidentified, unmanned object drifting toward the no-fly zone over the Negev Nuclear Research Center at Dimona, citing concern the object could be gathering intelligence on the reactor or carrying explosives. IAF sources characterized the object, within hours of the shootdown, as "probably a balloon." See the Dimona/Negev Unidentified Object Shootdown case file.
JD
Active 1968
Commanding Officer, Swift Boat PCF-19
Skipper of PCF-19 when it was struck by rockets from an unidentified source and sunk south of Tiger Island in the early hours of 16 June 1968, the incident immediately preceding the attack on HMAS Hobart. Davis was blinded and rescued badly wounded by USCGC Point Dume, one of only two survivors of an attack that killed four of his crew and a South Vietnamese liaison officer. See the HMAS Hobart / DMZ Vietnam Incident case file.
PS
Active 1968
Commanding Officer, Swift Boat PCF-12
Commanded PCF-12 when it responded to the sinking of sister boat PCF-19 on 16 June 1968 and fought a running gun battle with helicopter-type aerial contacts near Tiger Island, an engagement the Naval History and Heritage Command's own 2018 reassessment describes as "remarkably clear" eyewitness testimony of a genuine enemy helicopter attack. See the HMAS Hobart / DMZ Vietnam Incident case file.
BC
Active 1970s
Aviation Writer, Dallas Times Herald; Texas MUFON Director
A professional aviation journalist who, as Texas director of the Mutual UFO Network, led the most extensive investigation the Aurora UFO Crash story ever received. His 1972–73 fieldwork — interviewing elderly residents, coordinating a metal-detector search of Aurora Cemetery, and pursuing a failed exhumation request — is the direct source of nearly every specific physical-evidence claim later researchers on both sides of the debate continue to cite.
HH
Dec 29, 1943 – Sept 13, 2017
Founder & Director, International UFO Bureau (Oklahoma City)
Founded the International UFO Bureau in Oklahoma City in 1957 at age 13 and built it into an organization with contacts among police, media, and researchers nationally and abroad. Made the first modern outside investigation of the Aurora UFO Crash story in 1966, interviewing elderly Aurora residents and locating the grave in Aurora Cemetery later examined by Bill Case's 1973 MUFON investigation. On September 14, 1973, he wrote to Georgia Governor Jimmy Carter requesting a formal account of Carter's 1969 Leary, Georgia sighting; Carter's signed reply four days later became the case's only formal documentary record.
FT
1910 – 1984
Columnist, "Tolbert's Texas," Dallas Morning News (1946–1984)
A veteran Texas journalist and historian whose long-running local-history column investigated the old Aurora airship story in the 1960s, years before it became a national curiosity — part of the same Texas local-history journalism tradition that later informed the Texas State Historical Association's own skeptical assessment of the case.
DC
fl. 1987 – 1990
Editor, Gulf Breeze Sentinel
Editor of the weekly community newspaper who first published Ed Walters's anonymous "Mr. X" UFO photograph on November 19, 1987, printed alongside a letter purportedly from the anonymous photographer that Walters later admitted he had written himself. Cook continued running further Walters photographs and reader-submitted sightings through 1988 without independent verification, a decision critics later credited with converting one uncorroborated claim into a sustained, self-reinforcing community sighting wave.
CM
Active since 1988
Investigative Reporter, Pensacola News Journal
Journalist who conducted the most extensive independent newspaper investigation of Ed Walters's UFO claims, publicly criticizing the Gulf Breeze Sentinel's original coverage as "uncritical" and "sensationalist." Myers reported the June 10, 1990 discovery of a foam-and-paper UFO model in the attic of Walters's former home and had News Journal photographers reproduce several of Walters's Polaroid images using it. He later compiled his reporting into the 2006 book War of the Words: The True But Strange Story of the Gulf Breeze UFO.
RB
Active 1988 – 1990
Photo Analyst, Center for UFO Studies (CUFOS)
CUFOS analyst who, working alongside CUFOS scientific director Mark Rodeghier, identified multiple technical inconsistencies in Ed Walters's Polaroid photographs as early as 1988: unevenly spaced "windows" consistent with a hand-built model rather than a manufactured craft, an asymmetrical hull, a flawed bottom rim, and a rippling distortion suggesting the images were shot near or reflected off water. Boyd and Rodeghier were separately told by Walters's own acquaintances that he had a history as a practical joker who had spoken of pulling off "the ultimate prank." Boyd later said he was effectively frozen out of MUFON circles for voicing this skepticism while the organization was publicly endorsing the case as one of its best.
WA
1920 – 2015
Founder & International Director, Mutual UFO Network (MUFON), 1969–2000
Motorola plant manager whose own 1948 daylight formation sighting over Phoenix, Arizona led him to co-found MUFON in 1969; he directed the organization for 31 years. Andrus publicly championed the Gulf Breeze case, declaring by mid-1988 it was "the best case we've ever had," and after the 1990 model discovery he rejected the findings of MUFON's own reinvestigation team, siding instead with a revised distance calculation offered by Bruce Maccabee. His handling of the internal dispute prompted the resignation of MUFON's Director of Public Education in protest.
DW
Lieutenant Colonel, USAF (Ret.); MUFON Florida State Director
Retired Air Force fighter pilot with a mechanical engineering degree from Duke University who joined MUFON immediately after retiring in 1983 and became its Florida state director that same year. As MUFON's lead field investigator on the Gulf Breeze case from its earliest days, Ware personally interviewed hundreds of local sighting reports and more than a dozen self-described abductees, and remained a public defender of the case's authenticity even after the 1990 model discovery, later suggesting skeptic groups had planted the object to discredit Ed Walters.
RS
MUFON Field Investigators
Husband-and-wife MUFON investigator team assigned by Walt Andrus to formally reinvestigate Ed Walters's claims following the June 1990 model discovery. Over August and September 1990 the Salisberrys documented that the recovered model's hand-drawn details matched features Walters had described but that never appeared in his actual photographs, flagged serious procedural flaws in his 1988 polygraph exams, and reproduced one disputed photograph's impossible reflection geometry using a small model and double-exposure technique. When they reported these hoax indicators to MUFON leadership, Andrus publicly rejected their conclusions; both investigators said they were effectively pushed out of the organization afterward.
RW
fl. 1944 – 1945
War Correspondent, Associated Press
Dispatched to the 415th Night Fighter Squadron's base near Dijon, France in late December 1944 to investigate the squadron's growing internal reports, Wilson's resulting wire story — running on the front page of the St. Louis Post-Dispatch on January 2, 1945 and quickly syndicated nationally and internationally — is what broke the "foo fighters" nickname and phenomenon to the American public.
Italian Aeronautical Engineer & Author
Author of the postwar claim that the "foo fighters" were a real, SS-operated German secret weapon he called "Feuerball" ("fireball"). No wartime German document, captured hardware, or independent engineer's testimony has ever substantiated the device in the eighty years since Vesco first published the claim, and skeptical historian Kevin McClure's review found its specific technical details appear to originate solely with Vesco's own writing.
RP
Local BUFORA Coordinator; Retired Veterinary Surgeon
A retired Haverfordwest veterinary surgeon and the local coordinator for the British UFO Research Association (BUFORA), Pugh was contacted by a parent connected to the Broad Haven school sighting on the very afternoon of February 4, 1977, and drove out to interview witnesses and inspect the field that same evening. He went on to play the most active investigative and press-liaison role in bringing both the school sighting and the wider Pembrokeshire "Broad Haven Triangle" wave to national attention, and co-authored the case's first book-length account, The Dyfed Enigma (1979), with naturalist-author F.W. Holiday.
FH
1921 – 1979
Naturalist & Author
A naturalist and author whose interest in unexplained aerial phenomena began in 1966, Holiday joined Randall Jones Pugh in investigating the wider 1977 Pembrokeshire UFO wave that followed the Broad Haven school sighting, and co-authored the case's first book-length treatment, The Dyfed Enigma: Unidentified Objects in West Wales (1979), published shortly before his death. Holiday remained convinced until his death that the wave's stranger elements pointed toward genuinely paranormal, rather than purely extraterrestrial, phenomena.
LS
Founder, CRIFO (Civilian Research, Interplanetary Flying Objects); Later NICAP & MUFON Adviser
A Cincinnati-based public relations executive who founded CRIFO, one of the largest civilian UFO research groups of the mid-1950s, and published its newsletter Orbit from 1953 to 1957 while working in an unusual, semi-formal reporting relationship with Air Defense Command intelligence officers in Columbus, Ohio. After appearing alongside Rev. Gregory Miller on a WCPO-TV program, Stringfield obtained the original searchlight logs and surviving photographs behind the Norwood Searchlight Incident in 1954 and published the case's first serious analytical treatment, later included in his 1957 book Inside Saucer Post…3-0 Blue. He went on to serve as NICAP's public relations adviser (1957–1970) and a MUFON board member, and became best known in later decades for his self-published "Status Report" series on alleged UFO crash retrievals.
RL
fl. 1949
Managing Editor, Cincinnati Post
Witnessed the original August 19, 1949 sighting of the Norwood Searchlight Incident and, after the more detailed October 23 encounter, personally accompanied Rev. Gregory Miller to deliver a report and photographic material to Air Force intelligence officers at Wright Field in Dayton — a deliberate act of institutional reporting by a senior newspaper editor that helped route the case into official Project Grudge channels.
JS
fl. 1987–1998
Nadporučík (Senior Lieutenant), 51st Helicopter Regiment, Czechoslovak People's Army; regimental historian
A fellow pilot within the 51st Helicopter Regiment who, eleven years after the fact, gathered Captain Čestmír Tesařík's crew's account of their July 12, 1987 encounter into his own history of the unit, Jedenapadesátý aneb historie 51. vrtulníkového pluku vesele i vážně, first serialized in the June 1998 issue of L+K (Letectví + Kosmonautika) magazine. Every detailed secondary account of the Vranov nad Dyjí Helicopter Incident traces back to his work; sources disagree on whether he was himself aboard the helicopter that day or strictly its later chronicler.
JT
Schoolteacher (Instituteur); Field Investigator, Lumières dans la Nuit (LDLN)
A French schoolteacher who worked as a volunteer field investigator for the private ufology review LDLN, documenting several cases including Arc-sous-Cicon, Evillers, and the August 1972 Taizé Landing Case. His write-up of four close-range witnesses' testimony at Taizé remains the sole documentary source for that case's most dramatic details. A separate researcher, Robert Roussel, is recorded as having expressed skepticism about the "fantastique" quality of Tyrode's Evillers reporting, raising mass psychosis as a possible factor — a disclosed credibility caveat this catalogue's Taizé case file weighs directly rather than ignoring.
MJ
fl. 1990s–present
Yukon-Based Professional Engineer; Independent UFO Investigator
A professional engineer resident in the Yukon who, beginning in February 1999, tracked down and personally interviewed 19 of the 22 witnesses then known to the December 11, 1996 Fox Lake / Yukon mass sighting, eventually documenting 31 total witnesses across four communities. He posted his initial findings in October 1999 on ufobc.ca, updated the report in February 2000, and released a 43-page expanded version in June 2000 including eyewitness drawings, site maps, and trigonometric size-and-altitude calculations derived from cross-referenced angular-size estimates. He organized an October 2000 Whitehorse public UFO conference that drew 304 paid attendees, more than double the organizers' expectation. CUFOS ufologist Michael Swords and nuclear physicist Stanton Friedman both singled out his methodology as unusually rigorous for a civilian mass-witness case, though a 2012 satellite-tracking identification by Ted Molczan later proposed a conventional explanation for the underlying stimulus his investigation had documented.
MS
Ufologist, Center for UFO Studies (CUFOS)
A longtime CUFOS researcher and academic who, in the 2007 documentary Best Evidence: Top 10 UFO Sightings, called the December 1996 Fox Lake / Yukon sighting "possibly one of the best cases ever" on the strength of investigator Martin Jasek's methodical assembly of simultaneous, geographically dispersed witnesses. His endorsement was made before the case's 2012 conventional-explanation identification by Ted Molczan and is presented in this catalogue alongside that later analysis rather than in place of it.
MP
Writer, publisher; founder, Strange Attractor Press
British writer and Fortean Times contributing editor, author of Mirage Men (2010). Revisited Leon Davidson's weather-balloon hypothesis for the 1927 Roerich Expedition Sighting in his own research, weighing it against Brad Sparks's distance-and-scale objections and ultimately favoring the balloon explanation on probabilistic grounds, while acknowledging no specific balloon launch has ever been tied to the sighting.
Founder, The Black Vault; FOIA Researcher & Author
Founder in 1996, at age 15, of The Black Vault, an online archive of more than two million pages of U.S. government records obtained through the Freedom of Information Act. In September 2014, Greenewald received an anonymous letter enclosing a high-resolution copy of the 2013 Aguadilla FLIR video, which he posted publicly; the correspondent's note read, in part, "Alien technology is no doubt under the ocean near Puerto Rico!" Greenewald later reposted AARO's own officially released version of the footage after the March 2025 case resolution report. He is the author of Inside the Black Vault: The Government's UFO Secrets Revealed (2019) and formerly produced the History Channel's UFO Files series.
AK
Active 2021–present
Investigative Journalist, The War Zone (TWZ)
Working with co-reporter Marc Cecotti, Kehoe filed the Freedom of Information Act requests that produced the deck logs, briefing slides, and hundreds of gigabytes of automatic identification system (AIS) ship-tracking data underlying nearly the entire public record of the 2019 Navy destroyer drone swarm. Their reporting, published in a series of War Zone articles from 2021 through the Navy's 2022 video release, is the case's single most detailed primary-source reconstruction.
MC
Active 2021–present
Investigative Journalist, The War Zone (TWZ)
Co-reporter with Adam Kehoe on The War Zone's multi-year FOIA investigation into the 2019 Navy destroyer drone swarm, reconstructing the night-by-night timeline from deck logs, briefing slides, and civilian AIS ship-tracking data, and later obtaining the Navy's five officially released unclassified videos of the incidents in 2022.
DC
Cuban-born Novelist; MUFON Florida Volunteer Investigator
An established Cuban-born fantasy and science-fiction novelist who volunteered as a field investigator for MUFON's Florida chapter. Around mid-2013, an acquaintance of the CBP pilot who filmed the Aguadilla infrared footage contacted Chaviano with the video; she brought it to Florida MUFON director Morgan Beall, setting in motion the multi-year technical investigation that became the Scientific Coalition for UAP Studies' 2015 report.
MUFON Florida Chapter Director
Director of MUFON's Florida chapter who, after fellow volunteer Daina Chaviano brought him the leaked 2013 Aguadilla CBP infrared video, assembled a small team of researchers with technical and scientific backgrounds to vet the source and analyze the footage — the group that would go on to become the core of the Scientific Coalition for UAP Studies' (SCU) multi-year investigation of the case.
JC
fl. 2008
Journalist, The Sun
The Sun journalist whose June 20, 2008 report first brought the St Athan police helicopter sighting to national and international attention, framing it as a helicopter crew "attacked" by a UFO and forced into a high-speed chase across the Bristol Channel. Coles declined to identify his police sources, describing them only as "well-placed" — leaving his dramatized account without on-the-record attribution even as South Wales Police's own subsequent statement contradicted several of its central claims, including the existence of any sustained pursuit.
Soviet Philologist; Author, "Visitors from Outer Space," Sputnik (1966/67)
A Soviet academic — a philologist by training, not a materials scientist or archaeologist — who condensed the German Dropa stones story for Sputnik, the USSR's sensationalistic English-language export digest, giving it an unearned veneer of Soviet scientific authority. Zaitsev is the origin point of the story's pseudo-physical details: the claims that discs were shipped to Moscow and found to contain "a large amount of cobalt and other metals," to conduct electricity, and to hum on a special turntable — none of which was ever attached to any named institute, analyst, or report.
PK
1922 – 1984
Author, Non è terrestre / Not of This World (1969)
Pen name of Pier Domenico Colosimo, an Italian journalist ranked among the founders of modern pseudoarchaeology and, alongside Erich von Däniken, one of the two figures most responsible for carrying paleocontact claims into the international paperback market. His 1969 bestseller Non è terrestre, which won Italy's Premio Bancarella literary prize, is identified by researcher Jason Colavito as a principal vehicle for the Dropa stones story's entry into the anglophone fringe-archaeology audience. Held no training in archaeology, Chinese studies, or materials science; his work has been criticized for fabricated evidence and mistranslation.
Author, Sungods in Exile (1978), as "David Agamon" — Self-Confessed Hoaxer
British writer who, under the pseudonym "David Agamon," published Sungods in Exile: Secrets of the Dzopa of Tibet (Neville Spearman, 1978), presenting it as the posthumous notes of a nonexistent Oxford academic, "Karyl Robin-Evans," who supposedly contacted surviving Dropa in Tibet in 1947 and learned of their Sirius origin. Researchers were never able to locate Robin-Evans. In Fortean Times issue 75 (1995) Gamon publicly admitted he had written the book himself, that Robin-Evans never existed, and that the work was intended "partly a tribute to, but mainly a satire upon the many books aimed at the credulous" — a confession he restated in Fortean Times no. 109 (1998). Material from the hoax continues to be presented as fact in retellings of the Dropa legend.
German Author & Tour Operator; The Chinese Roswell (1998)
German writer and tour operator who revived the Dropa stones claim for a 1990s audience, travelling to China in March 1994 with co-author Peter Krassa and afterward reporting that the Banpo Museum's director had told them all traces of the discs had been ordered destroyed. The account is single-sourced, unwitnessed, and undocumented; no independent confirmation of the conversation, or of the discs themselves, has ever emerged. His 1998 book The Chinese Roswell: UFO Encounters in the Far East from Ancient Times to the Present is the vector by which several later embellishments — including the fictitious "Beijing Academy for Ancient Studies" attribution — entered general circulation.
AK
1906 – 2002
Soviet Science-Fiction Writer; Popularizer of Paleocontact Speculation
A real, prominent, and prolific Soviet novelist, engineer by training, chess composer, and pioneer of Soviet ufology — best known for popularizing the hypothesis that the 1908 Tunguska event was the explosion of a nuclear-powered alien spacecraft. Erich von Däniken names Kazantsev as the man who related the Dropa stones story to him in Moscow on May 18, 1968, recorded on a portable tape recorder while being driven to the Pushkin Museum. The chain of transmission that carried the Dropa stones into the English-speaking world therefore ran, at a key link, through a professional writer of fiction relaying a magazine story he had not verified.
Archaeologist; Bad Archaeology — Principal Bibliographic Debunker of the Dropa Stones
A working British archaeologist in North Hertfordshire whose May 7, 2007 article, "The Dropa (or Dzopa) stones," for the Bad Archaeology project he co-founded remains the most detailed public reconstruction of the story's transmission, and the basis on which most subsequent debunkings rest. He identified the untraceable "Reinhardt Wegemann" byline and "DINA" news agency behind the story's earliest print appearance, traced its ancestor to Soviet paleocontact writing of February 1960, and noted internal chronological inconsistencies indicating post-1962 rewriting. His 2011 follow-up notes that the Dropa stones remain the single most-searched subject on the Bad Archaeology site.
Author & Publisher, Adventures Unlimited Press
American author, born in France in 1957, who left the University of Montana in 1976 to travel in pursuit of his archaeological interests and later founded Adventures Unlimited Press (1984), a publishing house specializing in ancient mysteries, alternative history, and paleocontact speculation. His 1988 Lost Cities of Ancient Lemuria and the Pacific took the accumulated, multiply-mistranslated "Mahabharata nuclear weapon" fragments — already passed from Kisari Mohan Ganguli's 1880s prose translation through Pauwels and Bergier (1960), Erich von Däniken (1968), and Charles Berlitz (1972) — and reformatted them as free verse, making a nineteenth-century English paraphrase read as though it were a direct Sanskrit translation. By researcher Jason Colavito's count, Childress's versified rendering has since been reproduced, uncredited and without a single checkable verse citation, in more than thirty-five subsequent books.
Translator & Folklorist; Author of the Most Widely Circulated English Rendering of the Utsuro-bune Account
A professional Japanese-to-English translator specializing in folklore and the supernatural, known for his translations of Mizuki Shigeru's yōkai works and for his own book-length study of Japanese ghost belief, Yūrei: The Japanese Ghost. His 2014 translation and adaptation of the utsuro-bune account, published on his site Hyakumonogatari Kaidankai, is the version from which the overwhelming majority of English-language retellings of the story are ultimately drawn — usually without attribution. He is explicit that his text is adapted from several manuscripts together rather than a critical edition of one, and that the real story will probably never be known.
Scottish Paranormal Researcher & Author
A Scottish researcher and prolific author on UFOs and the paranormal, Halliday co-authored The Bonnybridge UFO Enigma (A Modern Day Mystery) with Malcolm Robinson, and separately wrote UFO Scotland: The Secret History of Scotland's UFO Phenomenon (1998) and Beyond the Falkirk Triangle (1998) — among the earliest book-length treatments of the Bonnybridge/Falkirk Triangle wave.
Co-Chairman & later Chairman, Los Angeles NICAP Subcommittee (LANS)
An objective LANS researcher who became the subcommittee's chairman following Dr. Leslie Kaeburn's 1968 death, Epperson led much of the multi-year investigation into Rex Heflin's 1965 UFO photographs, personally cross-checking U.S. Weather Bureau data on cloud cover for the disputed fourth "smoke ring" photograph and coordinating the two-year character investigation that established Heflin's reliability. She corresponded extensively with physicist James E. McDonald throughout his multi-year study of the case.
Principal Investigator, Los Angeles NICAP Subcommittee (LANS)
An engineer who checked ground equipment for the Apollo program at North American Aviation, Gray served as the principal on-the-ground LANS investigator for the Rex Heflin case beginning in September 1965, identifying the tree and telephone-wire reference points visible in Heflin's disputed fourth photograph and defending the smoke ring's authenticity against physicist James E. McDonald's persistent doubts in a detailed 1968 written exchange, arguing that "with Rex Heflin's reputation at stake, any explanations issued by science must be based on certainty."
UFO Researcher & Author; NICAP Investigator (1957–Present)
Druffel began investigating sighting reports in Southern California with NICAP in April 1957 and became personally acquainted with physicist James E. McDonald through the Los Angeles NICAP Subcommittee (LANS) from 1966 to 1971, later writing his authorized biography, Firestorm: Dr. James E. McDonald's Fight for UFO Science. When Rex Heflin's three lost original Polaroids mysteriously reappeared in his mailbox in 1993, Druffel arranged for all four originals to be preserved for scientific study, co-authoring the peer-reviewed 2000 reanalysis with Robert M. Wood and Eric Kelson that reconfirmed Heflin's account and found no evidence of a hoax.
Founder, Ground Saucer Watch (GSW)
A lay UFO researcher who founded Ground Saucer Watch (GSW) in Arizona, Spaulding obtained late-generation copies of Rex Heflin's 1965 photographs in the mid-1970s and, based on a computer enhancement conducted by GSW photographic consultant Fred Adrian, publicly declared in the group's 1975 News Bulletin that the images showed a supporting "string" and represented a hoax. Challenged by NICAP–LANS researchers who had worked from confirmed first-generation copies, Spaulding later conceded the linear feature might be a scratch rather than a string, but never formally withdrew GSW's hoax verdict; a 2000 peer-reviewed computer-enhancement reanalysis of Heflin's recovered original photographs found no trace of a string, scratch, or any other supporting mechanism. GSW's Heflin "string" claim later became a recurring cautionary reference point in the group's own decidedly mixed photo-analysis track record, cited again when GSW "authenticated" the disputed Lake Cote UFO Photograph in 1979.
AS
1920 – 1996
Journalist, Warminster Journal; Author & Sky-Watch Organizer
A features writer for the Warminster Journal who had previously served in the Grenadier Guards and the Air Ministry Constabulary, Shuttlewood began investigating unexplained sounds reported by Warminster residents from January 1965, following Marjorie Bye's account of a strange sound heard on Christmas Day 1964. Initially skeptical, he grew convinced of the phenomenon's genuineness after collecting numerous witness statements and, by his own account, personally sighting an object from his own window later that year. He forwarded Gordon Faulkner's September 1965 photograph to the Daily Mirror, bringing the "Warminster Thing" to national attention, and went on to organize regular public sky-watch gatherings at Cradle Hill that drew thousands of visitors to the town. He wrote seven books on the phenomenon between 1967 and 1981, beginning with The Warminster Mystery.
Author & Researcher; Co-Author, In Alien Heat and History of a Mystery
A Warminster-raised technical author, Dewey co-wrote the two most substantial modern re-examinations of the "Warminster Thing": In Alien Heat: The Warminster Mystery Revisited (2006, with John Ries) and History of a Mystery: Fifty Years of the Warminster Thing (2009, with Kevin Goodman). Rather than arguing for or against an extraterrestrial explanation, both books treat the decade-long wave primarily as a social and folkloric phenomenon, drawing on the authors' own nights spent sky-watching alongside witnesses and researchers at Cradle Hill.
SN
1887 – 1972
Self-Described Oilman & Geophysicist; Convicted Fraudster
The actual originator of the 1948 Aztec, New Mexico crashed-saucer story later publicized by Frank Scully, Newton presented himself as a successful oil-locating geophysicist while privately compiling a long record of dry wells, unpaid creditors, and prior fraud allegations dating to 1938. He and Leo GeBauer used the crashed-saucer narrative to market fraudulent magnetic "doodlebug" oil-detection devices, and both were convicted of fraud and conspiracy in Denver in December 1953.
LG
Phoenix Radio & Electronics Dealer; the Real “Dr. Gee”; Convicted Fraudster
GeBauer was the real identity behind "Dr. Gee," the anonymous top government scientist Silas Newton credited as his own source for the Aztec crashed-saucer story. In reality a Phoenix dealer in radio and television parts with no verifiable advanced scientific credential, GeBauer operated under numerous documented aliases and was convicted of fraud and conspiracy alongside Newton in Denver in December 1953.
San Francisco Chronicle Reporter; Author, “The Flying Saucers and the Mysterious Little Men” (1952) & “Flying Saucer Swindlers” (1956)
Cahn's 1952 investigation for True magazine exposed the Aztec crashed-saucer story as a fraud built to market bogus oil-detection devices, identified "Dr. Gee" as Leo GeBauer, and had a sample of the claim's supposedly indestructible alien metal tested — it was ordinary aluminum. His reporting directly enabled the criminal investigation that led to Silas Newton and GeBauer's 1953 fraud conviction.
AB
1921 – 2016
Founder, International Flying Saucer Bureau; Origin Source of the “Men in Black” Claim
A Bridgeport, Connecticut factory timekeeper, Bender founded the International Flying Saucer Bureau in 1952 and abruptly shut it down in late 1953, later claiming three men in dark suits had visited and telepathically warned him into silence. Gray Barker's dramatized 1956 book made the claim the founding account of the "Men in Black" figure in UFO folklore; Bender's own, substantially different 1962 account contradicted Barker's version. No independent corroboration of any version exists.
GB
1925 – 1984
UFO Writer & Publisher; Author, They Knew Too Much About Flying Saucers (1956)
A West Virginia writer who investigated the 1952 Flatwoods Monster case before becoming an Albert Bender associate, Barker's 1956 book dramatized Bender's claim into the founding account of the "Men in Black" figure in UFO folklore. Barker carries a separately, extensively documented reputation — by his own later admissions and by the independent testimony of friends and collaborators — for fabricating and embellishing UFO stories for commercial gain throughout his career, a reputation directly relevant to weighing his own most famous account.
ED
Active 1990s–2000s
UFO Researcher, Operation Right to Know
A UFO disclosure-advocacy researcher who, in February 1992, received an anonymous letter signed only "J.S." and claiming membership in an unverified group called the "Deneb Team," describing an alleged 1974 UFO crash and covert recovery near Coyame, Chihuahua, Mexico. Douglass passed the document to Leonard Stringfield, who published it in 1994 — the claim's first documented appearance in any form, eighteen years after the events it describes.
NT
Active 2000s–2010s
MUFON-Affiliated Researcher & Author
A Texas-based MUFON member with a Bachelor's in English and a Master's in Library Science from the University of Texas at Austin, Torres co-authored, with Ruben Uriarte, the two principal book-length treatments of the Coyame, Mexico UFO Crash Claim: Mexico's Roswell (2007) and The Coyame Incident (2013), the latter including laboratory analysis of recovered metal fragments that returned inconclusive results.
RU
Active 2000s–2010s
UFO Researcher & Author
Co-author, with Noe Torres, of the two principal book-length investigations of the Coyame, Mexico UFO Crash Claim, contributing further regional research and physical-evidence collection to the case's 2013 expanded treatment, The Coyame Incident.
AM
1919 – 1992
French Science Writer & Independent Ufologist
French journalist and independent UFO researcher, known for his controversial "orthoteny" theory of geometrically aligned sighting patterns and for conducting some of the earliest, most detailed personal interviews with Maurice Masse in the months after the July 1965 Valensole encounter, publishing the case's first in-depth writeup in Flying Saucer Review.
BT
Aviation Journalist, Historian & Author; Iranian Air Force Historical Researcher
An Iranian-born aviation journalist and military historian who began publishing anonymous histories of the Iranian Air Force in 2005 before moving into English-language defense media (AirForces Monthly, Combat Aircraft) and, in 2011, co-supervising the IRIAF's own "Historical Identity" research project. Taghvaee has since built a substantial, independently credentialed body of work — several Osprey/Helion military-history books and OSINT reporting for Radio Free Europe, Israel Hayom, and the BBC — but the single claim of his that has traveled furthest outside specialist aviation circles is his October 2013 Combat Aircraft article describing IRIAF F-14 and F-4 crews chasing "luminous objects" believed to be U.S. reconnaissance drones near Iran's nuclear sites from 2004 onward, sourced entirely to unnamed Iranian air force contacts he said he interviewed over roughly two years. That single, single-authored account — including its central claim about a November 2004 radar intercept near Arak — has never been independently corroborated by a named Iranian pilot, a second journalist's own reporting, or any released Iranian document, and is the sole source underlying nearly every subsequent English-language article on the topic.
MW
b. 1965
Independent Analyst; Founder, Metabunk.org
Former video-game programmer turned independent skeptical investigator. Published the first detailed public parallax analysis of the GoFast video, arguing it showed a slow, high-altitude balloon rather than a fast-moving craft — a conclusion later closely echoed by AARO's official 2025 case resolution. Separately proposed that Gimbal's apparent rotation is a camera-relative infrared-glare artifact of a conventional aircraft rather than a physical property of the tracked object. On the USS Omaha sphere clip, West has argued the released footage is too low-resolution and grainy to determine what it actually depicts before it passes beyond the visible horizon, and that the deck-log/VMS records the Navy says were never created for that period are a genuine evidentiary gap rather than proof of a cover-up. On the "Mosul Orb", West's own public assessment visibly evolved as better data became available: a tentative 2023 discussion of a leaked still image gave way, once the full 2025 video was released, to a specific public statement that the footage "seems consistent with a large balloon." On AARO's 2022 "Middle East Object" footage, West's Metabunk forum independently measured the background's apparent rotation rate and concluded it was consistent with the MQ-9's own orbiting flight pattern, reinforcing Bellingcat's separate parallax-based balloon conclusion.
TR
Active journalist
Defense Journalist; Editor-in-Chief, The War Zone (TWZ)
Defense and aerospace journalist whose outlet, The War Zone, published the first detailed public investigation into Lt. Ryan Graves's squadron-mates' "cube in a sphere" description. In November 2019, Rogoway surfaced a 1945 U.S. patent for a folding, balloon-borne "airborne corner reflector" whose internal geometry — a cube-shaped metal reflector frame suspended inside a spherical envelope — is a close visual match for the pilots' account, and connected it to the CIA's Cold War-era Project PALLADIUM radar-deception balloons. He has been careful to frame the match as a serious, testable candidate explanation rather than a confirmed identification.
CS
Active researcher
Independent UFO Video Analyst
An independent UFO investigator whose public work centers on frame-by-frame technical analysis of viral UAP video clips. On the December 2021 South China Sea UAP Wave footage, Spitzer publicly assessed the light pattern as consistent with flares, noting each point of light burned for roughly six to seven seconds — in line with published military flare burn-time specifications — and that lights released earlier in the sequence appeared lower in the frame than later ones, the pattern expected of a moving aircraft releasing flares sequentially rather than a stationary or maneuvering structured craft. Limited independent biographical information beyond his published video-analysis commentary was located for this profile.
Open-Source Investigator, Bellingcat
A Colorado-based open-source researcher and former Georgetown University adjunct professor specializing in Middle East infrastructure and information operations. Co-authored Bellingcat's October 2023 investigation "Isn't That A Balloon? Deflating a DoD UFO Video," which geolocated the AARO "Middle East Object" footage to a specific site northeast of Deir ez-Zor, Syria, and argued the object was most likely a Mylar party balloon released during Eid al-Adha.
Technology Officer & Senior Data Scientist, Bellingcat
An MIT-trained electrical engineer and physicist leading Bellingcat's Investigative Technology team, with a background in optics, signal processing, and geospatial data visualization. Co-authored Bellingcat's October 2023 analysis of the AARO "Middle East Object" video, using matched Google Earth ground features and a building-wall pixel measurement to estimate the filmed object's maximum width at roughly 0.43 meters — well below AARO's own stated typical UAP size range.
CS
b. 1958
Chairman, UFO-Sweden; vice-chairman, Archives for the Unexplained (AFU); journalist, Dagens Nyheter
Sweden's most prominent UFO researcher, investigating cases since 1974 and a professional journalist at the country's largest newspaper since 1990. Svahn has led the modern archival reconstruction of the 1946 ghost rocket wave, including a 1984 interview with search commander Karl-Gösta Bartoll and locating additional living witnesses decades after the fact. He co-authored the academic survey UFOs and Government: A Historical Inquiry (2012) and chairs AFU, which holds the world's largest paranormal-phenomena archive, including more than 25,000 Swedish UFO reports and the original ghost rocket case files. Separately, Svahn spent over 100 recorded hours across two decades interviewing Gösta Carlsson about his claimed 1946 Ängelholm encounter, co-authoring the book-length investigation Mötet i gläntan (1995) with him.
ES
1923–1987
Science journalist & illustrator; first public investigator, Ängelholm case
A Swedish science journalist and Stora journalistpriset (Grand Journalism Prize) winner, also known for illustrating the space-adventure comic strip Allan Kämpe and authoring more than a dozen UFO and speculative-topic books between 1952 and 1986. In fall 1971, Semitjov conducted Gösta Carlsson's first-ever public interview about the 1946 Ängelholm encounter, visited the clearing with him to document the claimed ground impression, and submitted Carlsson's quartz-like rod to Stockholm University's mineralogical department without disclosing its origin — a blind test that found the object to be ordinary quartz.
PI
Connecticut Science Teacher & Amateur Astronomer; Lead Field Investigator, Hudson Valley UFO Wave
A public high school science teacher and amateur astronomer in Greenwich, Connecticut, Imbrogno became the principal field investigator of the Hudson Valley UFO Wave beginning in 1982, operating a witness hotline and collecting depositions that grew into a database of more than 7,000 reports between 1982 and 1995. He partnered with J. Allen Hynek and journalist Bob Pratt to co-author Night Siege: The Hudson Valley UFO Sightings (1987), Hynek's final published work. Imbrogno's later career was seriously damaged in July 2011 when researcher Lance Moody demonstrated that his claimed physics, astronomy, and chemistry degrees from the University of Texas and MIT — including a purported 2010 Ph.D. in theoretical chemistry from MIT — were fabricated; MIT's registrar confirmed no student of that name had ever been enrolled, and a separately claimed record of Green Beret special-operations service in Cambodia was also found to be invented. Imbrogno withdrew from public UFO research shortly afterward. The credential exposure does not itself invalidate the independently corroborated, named witness testimony (including a Yorktown police officer's own account) that underlies the Hudson Valley case, but it is a legitimate and material reason to treat Imbrogno's own claimed investigative rigor — particularly the precise "7,000 cases investigated" figure attributed to his team — with added caution rather than at face value.
RL
Active 1966 – 1968
Assistant Dean of the Graduate School; Project Coordinator, Condon Committee
A University of Colorado administrator who served as the Condon Committee's day-to-day project coordinator while director Edward Condon remained largely detached. On August 9, 1966, before the Air Force contract was even signed, Low wrote an internal memo to two university administrators proposing "the trick" of describing the study "so that, to the public, it would appear a totally objective study but, to the scientific community, would present the image of a group of nonbelievers trying their best to be objective, but having an almost zero expectation of finding a saucer." The memo, discovered by staff in 1967 and leaked to the press in 1968, became the central piece of evidence for critics who argued the study's negative conclusion had been decided before any fieldwork began. Low resigned from the project in May 1968 amid the ensuing controversy.
KB
fl. 1970s–present
Australian UFO Researcher, UFO Research Australia / UFO Research South Australia
A veteran Australian UFO investigator who led the on-the-ground inquiry into the Knowles family's January 1988 report, initially calling it "an extraordinary example of a close encounter that had left physical traces," and co-authored UFO Research Australia's contemporaneous newsletter write-up with R. Brooke. When a strikingly similar light was reported along the same stretch of highway that October, Basterfield investigated independently and identified the light as the planet Jupiter, distorted by the same kind of atmospheric refraction implicated in the January case.
Medical Sociologist & Author
A sociologist specializing in mass psychogenic illness and collective delusions who, in UFOs & Alien Contact: Two Centuries of Mystery (1998), classified the Knowles family's experience as a "small group panic" — his term for episodes in which fatigue, darkness, isolation, and mounting fear cause otherwise normal people to misinterpret ambiguous stimuli as a coordinated, life-threatening attack. He concluded the family, exhausted from a marathon overnight drive on an unfamiliar road, most likely mistook an anomalous light for a pursuing spacecraft, given the absence of any corroborating physical evidence that survived laboratory testing. His 1990 Skeptical Inquirer paper "The Airship Hysteria of 1896-97" was among the first to frame the earlier American mystery-airship wave within this same sociology-of-collective-delusion framework, concluding, in his own compact phrase, that during the wave "believing was seeing."
JO
Aerospace Journalist & Analyst; former NASA Johnson Space Center Flight Controller
A NASA Johnson Space Center flight controller and one of the few Western analysts of his era capable of reading Soviet space activity from open-source and tracking data alone. Independently identified the launch of the Kosmos-955 satellite from the secret Plesetsk Cosmodrome as the likely stimulus for the Petrozavodsk Phenomenon after confirming the launch time directly with NASA's own satellite-tracking center. Author of Red Star in Orbit (1981) and UFOs and Outer Space Mysteries: A Sympathetic Skeptic's Report (1982); became one of the most prolific skeptical analysts of Soviet-era UFO reports, later tracing a comparable satellite-launch stimulus behind a June 1980 sighting. Wrote OMNI magazine's "UFO Update" column in the late 1970s, where his December 1978 item on the 1973 Coyne helicopter incident defended Philip J. Klass's meteor/pilot-error explanation as more scientifically careful than critics credited, drawing a published rebuttal from reader Charles Labbe.
CC
Active 2000s
Researcher, Instituto Nacional de Pesquisas Ufológicas (INPU)
A Brazilian ufology researcher who, working with Paola Covo through the INPU and publishing in Revista UFO (Edition 82, March 2002), produced the definitive technical debunking of the Barra da Tijuca photographs. Rather than simply re-examining the existing prints, Covo physically returned to the beach on the same calendar date and time of day to measure the sun's real position, calculating that the shadow cast by the object in the fifth photograph would require the sun to be located inside the Atlantic Ocean — a physical impossibility that converted decades of qualitative shadow-mismatch observations into a single, quantitative, falsifiable finding.
JM
Active 1952 – 1960s
Journalist, O Cruzeiro magazine, Rio de Janeiro
A staff journalist for the Rio de Janeiro illustrated weekly O Cruzeiro, already known within Brazilian ufology for co-producing, with photographer Ed Keffel, the widely published but later thoroughly debunked 1952 Barra da Tijuca photographs of a disc-shaped object. In November 1957, after Antônio Vilas-Boas read Martins's own UFO reporting in the magazine, Vilas-Boas wrote to him describing his claimed encounter and enclosed a wood model of the craft he said he had seen. Martins financed Vilas-Boas's trip to Rio de Janeiro and, on February 22, 1958, brought him to meet Dr. Olavo Fontes, setting the medical investigation in motion.
WB
b. Germany, emigrated to Brazil 1933 – d. 1996
Physician; Founder, Sociedade Brasileira de Estudos sobre Discos Voadores (SBEDV)
A German-born physician who settled in Brazil in 1933 and founded the SBEDV in 1957, leading it for three decades and editing its bulletin, in which the Vilas-Boas case received its first known print reference, in the April–June 1962 issue — more than four years after the claimed event. In 1978, two decades after the fact, Bühler stated that Dr. Olavo Fontes had used a Geiger counter during the 1958 examination and detected radioactive contamination on Vilas-Boas; this claim was never published in full or corroborated by any contemporaneous 1958 record, and this catalogue treats it as an unverified secondhand recollection rather than established instrumented data.
CS
active 1990s–present
Historian & Ufologist
A Brazilian historian and ufologist who, working with Spanish researcher Pablo Villarrubia Mauso in the second half of the 1990s, traveled to Araçariguama and interviewed surviving relatives of João Prestes Filho, including elderly cousin Vergílio Francisco Alves. Suenaga's most consequential contribution was recovering the original 1946 death certificate from the Santana de Parnaíba civil registry — the single primary document anchoring the case's official date, time, and medically certified cause of death. He and Mauso co-published their findings as João Prestes y las crónicas del misterio (Madrid, 2001).
BH
1931 – 2011
Artist, Author & Abduction Researcher
A New York-based artist who became one of the most prominent American investigators of alien-abduction claims, largely through his 1981 book Missing Time, which helped codify the "missing time" narrative framework as a recognized category within ufology. Researchers connected to his team personally interviewed John Vasquez in the early 1990s regarding his Fort Benning Abduction Case claims and ultimately declined to pursue the investigation further, with one participating researcher describing the account as "extremely convoluted" and privately suspecting a hoax.
Astronomer, Observatório Nacional (National Observatory), Rio de Janeiro
A Brazilian astronomer who joined the National Observatory in 1956, earned his doctorate from the University of Paris in 1967, and went on to found Brazil's Museum of Astronomy and Related Sciences (MAST) and co-found the Brazilian Astronomical Society. Days after the February 1982 Ceará Boeing 727 Sighting, Mourão publicly proposed that the object VASP Flight 169's crew and passengers observed was the planet Venus — the seed of the conventional explanation later developed in full quantitative detail by researcher Luiz Augusto da Silva's 2014 Journal of Scientific Exploration reconstruction.
GC
1908 – 2003
British Diplomat; Contributor and later Editor, Flying Saucer Review
A career British diplomat with postings across Europe, the Americas, and China, who became a regular contributor to the British magazine Flying Saucer Review from its founding in 1955 and served as its editor from 1982. Creighton's English-language translations and summaries of Olavo Fontes's Portuguese-language reports, published in Flying Saucer Review beginning in early 1965 and later collected in the 1969 anthology The Humanoids, are the source through which the Vilas-Boas case first became widely known outside Brazil — nearly eight years after the claimed encounter.
TB
Active 1980s – present
Folklorist; Author, UFO Abductions: The Measure of a Mystery
A folklorist and board member of the Center for UFO Studies and the Fund for UFO Research whose 1987 two-volume study UFO Abductions: The Measure of a Mystery remains the most comprehensive comparative analysis of abduction narratives ever published. Bullard identifies the Vilas-Boas case as the narrative template — capture by small humanoids, a medical examination, and a reproductive or genetic motive — that later, better-known cases such as Betty and Barney Hill's 1961 encounter would continue rather than originate.
PR
Co-Editor, Magonia Magazine; Proponent of the Psycho-Social Hypothesis
A British Fortean researcher who, alongside Roger Sandell, helped develop the Psycho-Social Hypothesis of UFO phenomena through more than five decades of work on the magazines MUFOB and Magonia. In a 1993 Magonia article, "Notes towards a revisionist history of abductions," Rogerson argued the Vilas-Boas narrative shows specific overlap with a similar story published in the Brazilian magazine O Cruzeiro in November 1957 and with the contactee literature of George Adamski, and criticized early investigators for assuming, on unexamined class prejudice, that a "peasant" farmer could not have invented so detailed an account.
MO
Active 2000s–2010s
Hypnotherapist
Conducted the July 14, 2008 MUFON-arranged regressive hypnosis session with Chris Bledsoe, described in accounts of the session as Harvard-affiliated with roughly 250 prior regression sessions. Bledsoe recalled contact with tall entities he interpreted as protective, guardian figures.
DG
Active 2000s
Psychiatric Social Worker
Conducted MUFON's 2008 psychological evaluation of Chris Bledsoe, finding no evidence of psychopathology or a profile consistent with deliberate fabrication.
MUFON Field Investigation Team
The four field investigators who, alongside International Director James Carrion, interviewed Chris Bledsoe and the other original 2007 witnesses and found their accounts independently consistent.
Businessman; Intermediary
The intermediary who connected Chris Bledsoe to John B. Alexander around 2015. Separately and independently of the Bledsoe case, Frascella and his brother operated a payday-loan business, Cash Today, that Pennsylvania regulators and a class-action lawsuit alleged charged unlicensed interest rates of 400–500%, resulting in litigation and bankruptcy — a background detail skeptical researchers have flagged when assessing the network around the case.
AB
Researcher
One of three witnesses, alongside Chris Bledsoe and Sarah Gamm, present for a widely discussed 2025 nighttime sighting over Washington, D.C., subsequently discussed on NewsNation's Reality Check with Ross Coulthart.
PB
Investigative Journalist
An award-winning broadcast journalist (Yale '93; Columbia Journalism School) whose prior work appeared on ABC News, Al Jazeera, PBS, and CBS News, including Peabody and DuPont Award-winning 9/11 coverage. Serves as lead investigator on History Channel's Beyond Skinwalker Ranch, applying investigative-journalism methodology to its 2023 profile of Chris Bledsoe and a 2025 follow-up segment.
JM
Podcast Host, American Alchemy
A Columbia University graduate and Thiel Capital investor who hosts American Alchemy, a podcast bridging Silicon Valley culture with UAP, consciousness, and frontier-science research, featuring guests including Garry Nolan and Avi Loeb. Interviewed Chris Bledsoe at length about his relationship with Tim Taylor.
RK
fl. 1974
MUFON Field Investigator; Art Teacher, Rawlins, Wyoming
A local art teacher and Mutual UFO Network field investigator, Kenyon was among the first to interview Carl Higdon after the October 25, 1974 encounter and notified Dr. Leo Sprinkle at the University of Wyoming, setting the case's formal investigation in motion. He also produced a composite sketch of the "Ausso One" entity from Higdon's description. Later analysis of the case's hypnosis-session transcripts has flagged Kenyon's own active presence and prompting during those sessions as a possible source of narrative contamination.
JB
fl. 1976
Mutual UFO Network Field Investigator
A MUFON field investigator who made the initial contact with Louise Smith, Mona Stafford, and Elaine Thomas in early 1976 and opened MUFON's formal case file on their encounter. Along with fellow investigator Leonard Stringfield, Black was later identified — by both the case's own polygraph examiner and APRO's own published bulletin — as having shown the women standardized alien-entity sketches before they produced their own independent drawings, a procedural criticism that has followed the case ever since.
WW
Metallurgy Consultant, Aerial Phenomena Research Organization (APRO)
The metallurgist APRO retained to examine the deformed 7mm rifle bullet Carl Higdon recovered after his October 1974 encounter. Like the local police examiner who looked at it independently, Walker could not identify an ordinary mechanical or chemical process that explained the bullet's missing lead core and inverted, "turned inside out" copper jacket, though the object was never subjected to modern instrumental re-testing or isotopic analysis and its present whereabouts are not documented in any source consulted for this case file.
KY
1966 – 2005
UFO Investigator; Ohio MUFON State Section Director; UFO Research: Cincinnati
A Cincinnati cable-television info-channel coordinator and independent UFO investigator known among peers for a careful, deliberately skeptical "just the facts" approach, Young spent roughly two years confirming the date of the Trumbull County, Ohio incident after learning of it secondhand, locating a surviving backup copy of the county's own missing 911 dispatch tapes in May 1998 and interviewing the involved officers directly. His FOIA requests for official records were denied. He died of leukemia on January 31, 2005, at age 38.
LG
Loren Gross
Active 1960s–2010s
Independent UFO Historian; Founding Member, Sign Historical Group
Fremont, California-based UFO historian and retired General Motors employee whose privately published, decades-long chronological history of early ufology, UFOs: A History, documents the Redmond, Oregon case (including the radar track designator "JB 129") in unusual day-by-day detail drawn from contemporaneous newspaper and FAA records.
CS
Active 1970s – present
Independent Researcher; Co-Founder, Shag Harbour UFO Incident Society
Nova Scotia-based researcher who began informally collecting testimony on the Shag Harbour UFO incident in the 1970s and formally reopened the case in 1993 with co-author Don Ledger, obtaining official Royal Canadian Navy dive-search records through federal Access to Information requests. Co-author of Dark Object (2001) and, with Graham Simms, Impact to Contact (2018); co-founder of the Shag Harbour UFO Incident Society.
DL
Active 1990s – present
Independent Researcher & Author
Bedford, Nova Scotia-based UFO researcher and writer who partnered with Chris Styles from 1993 onward to re-investigate the Shag Harbour UFO incident, co-authoring the definitive 2001 account Dark Object: The World's Only Government-Documented UFO Crash. Also the author of Maritime UFO Files, a broader survey of Atlantic Canadian sightings, and the aviation-disaster book Swissair Down.
JF
Active 1990s – present
Documentary Filmmaker
American documentary filmmaker whose 2022 feature Moment of Contact and its 2025 expanded edition, Moment of Contact: New Revelations of Alien Encounters, reintroduced the Varginha case to a global audience and helped surface neurosurgeon Dr. Ítalo Venturelli's testimony. Fox organized the January 20, 2026 National Press Club press conference marking the case's 30th anniversary and has separately directed UFO documentaries including Out of the Blue and The Phenomenon.
TT
Active 1990 – present
Independent researcher; CUFOS consultant; founder, Sign Oral History Project
A Minneapolis-based documentary filmmaker turned UFO historian, Tulien began interviewing Bradford Runyon in May 2000 and spent over two decades building the most detailed independent investigation the Minot Air Force Base case has ever received, digitizing the full 145-page Project Blue Book file and documenting specific problems in Lt. Col. Werlich's original methodology. He also authored CUFOS case studies of the Selfridge AFB (1950) and Lakenheath-Bentwaters (1956) radar-visual incidents and founded the Sign Oral History Project in 1999.
Sociologist & Lead Investigator, Łódź
A Łódź-based sociologist and independent UFO researcher who led the central investigation of Jan Wolski's 1978 encounter, assembling a multidisciplinary team from the University of Łódź and publishing his findings as Zdarzenie w Emilcinie (1978). Later acknowledged deliberately seeding false confirmatory details into public accounts as an authenticity test, a practice that has drawn methodological criticism for contaminating the case's own evidentiary record.
Amateur Ufologist
The first researcher to interview Jan Wolski, arriving in Emilcin around May 26, 1978, weeks before Zbigniew Blania-Bolnar's team began its own investigation. Decades later, publicist Bartosz Rdułtowski accused Wawrzonek of orchestrating the entire episode through hypnotic suggestion as an act of professional revenge — an allegation Wawrzonek's family has disputed and that remains unproven.
Publicist & Researcher
Reviewed Zbigniew Blania-Bolnar's personal archive after the sociologist's 2003 death and, in 2012–13, publicly proposed that the Emilcin case was an elaborate hoax involving hypnotic memory implantation orchestrated by Witold Wawrzonek. Also flagged leading-question problems in Blania-Bolnar's own interview technique, while ultimately concluding the full truth of the case may never be conclusively established.
Journalist, Poland
Conducted and tape-recorded an extensive interview with Jan Wolski in July 1978 alongside Henryk Pomorski, producing the earliest surviving audio primary source of Wolski describing the Emilcin encounter in his own words.
Journalist, Poland
Co-conducted the July 1978 tape-recorded interview with Jan Wolski alongside Krystyna Adamska, a key primary source preserving Wolski's own detailed account of the Emilcin encounter.
Investigator; Co-Founder, Círculo Argentino de Investigaciones Ufológicas (CADIU)
The principal early investigator of the Trancas Case, Galíndez compiled more than a decade of documentation into the "Trancas File" and published the definitive 1974 synthesis, "Los asombrosos fenómenos de Trancas," in OVNIS magazine. He also served as the Aerial Phenomena Research Organization's Argentine correspondent, the same international network Coral Lorenzen co-founded.
Skeptical Researcher, Argentina
Published the Trancas Case's most serious conventional-explanation challenge in the late 1980s and early 1990s, arguing the Moreno family witnessed a nighttime Army convoy and searchlights during a documented anti-guerrilla training exercise active in the region that week — a hypothesis disputed by Capt. Daniel Perisse.
DP
Argentine Navy Officer; Researcher — Rebuttal Investigator
As a young lieutenant, commanded the Argentine Naval Detachment on Deception Island during the June–July 1965 Deception Island Sightings, personally witnessing the case's central 62-minute July 3 observation and giving the radio confirmation quoted in the Argentine Navy's official bulletin. The experience launched a second career: he served on Argentina's Permanent Commission for the Investigation of the UFO Phenomenon from 1966 to 1974, presented a detailed technical paper on his own Antarctic sighting at the 1987 MUFON International UFO Symposium, and, separately, published a 1990 rebuttal to Roberto Banchs's military-convoy hypothesis for the Trancas Case, arguing the specific Army regiments active in the area that week did not possess the mechanized or armored equipment the hypothesis requires.
Director, Planeta UFO
Published a 2005 documentary review revisiting the full archival record of the Trancas Case, part of continued Argentine and international ufological interest in the case more than four decades after the original sighting.
FZ
1928 – 2023
Ufologist & Television Host, Argentina/Uruguay
One of Argentina's most prominent and prolific ufologists, author of dozens of books including El OVNI y sus Misterios (1978), Zerpa cited the Trancas Case as a formative influence on his decades-long research career and separately investigated other prominent Argentine sightings, including a 1973 claimed abduction near Bahía Blanca.
GC
b. 1954; active 1975–present
UFO Researcher & Author
A Manitoba native whose entry into ufology began in May 1975 with his own repeated sightings of the light that became known as Charlie Redstar near Carman, Cameron spent the following eighteen months photographing the phenomenon and personally interviewing hundreds of the wave's witnesses, and for a time led informal viewing tours out to the Diemert family's field. He went on to become one of North America's best-known UFO researchers, focusing heavily on U.S. presidential-level UFO briefings and government disclosure history, and returned to his original case more than four decades later with Charlie Red Star: True Reports of One of North America's Biggest UFO Sightings (Dundurn Press, 2017), a witness-account-driven book widely credited with reviving public interest in the case, including Manitoba's 50th-anniversary commemorations in 2025.
Field Investigator, Mutual UFO Network (MUFON)
A MUFON investigator who assisted Raymond Fowler's multi-year investigation of the Allagash case beginning in 1989, and who later presented related material at the Abduction Study Conference held at the Massachusetts Institute of Technology in June 1992.
BR
Active 2024
Investigative Writer, Skeptical Inquirer (Committee for Skeptical Inquiry)
Author of "The Berkshire UFO Abduction Incident" (Skeptical Inquirer, Nov./Dec. 2024), the most detailed published skeptical examination of the Berkshire case, undertaken after a television production company asked him to assess its credibility. Radford's reporting documents the absence of contemporary police, newspaper, or photographic corroboration for the 1969 event and identifies recovered-memory technique and decades of mutual witness influence as the most likely drivers of the case's specific abduction content.
WW
Active 1976–present
Founder & Leader, CENAP (Centrales Erforschungsnetz außergewöhnlicher Himmelsphänomene)
Leader of the German skeptical research group CENAP since 1976. In 1994, Walter published an investigation into the Greifswald Lights proposing that the objects were Warsaw Pact naval signal/illumination flares ("Tannenbäume") fired in the Baltic "Luftschießzone II" exercise zone, drawing on testimony from a former NVA officer and a former East German Air Force press spokesman, plus limited corroborating correspondence from the Swedish Ministry of Defence and Germany's Federal Office for Military Technology and Procurement. His explanation remains the most widely repeated conventional account of the case in German media, though it has never been confirmed by a named unit or exercise record, and Illobrand von Ludwiger directly disputed it on flare-duration grounds.
DK
Active 2012
Independent Researcher, ufo-information.de
Published a November 2012 investigation proposing that the Greifswald Lights were Czechoslovak Air Force SAB-type illumination bombs, each releasing seven parachute-suspended pyrotechnic flares from roughly 10 km altitude — an explanation distinct from and inconsistent with Werner Walter's earlier 1994 naval-flare theory. Kirstein directly contacted embassies, military archives, and defense ministries of former Warsaw Pact states to confirm his theory, an effort that largely failed to produce documentary confirmation, which he attributed to record loss during the Warsaw Pact's 1991 dissolution. His conclusion was publicly disputed within weeks by DEGUFO military historian Marius Kettmann.
MK
Active 2012
Military Historian, DEGUFO (Deutsche Gesellschaft für UFO-Forschung)
A DEGUFO military historian who, within weeks of Dennis Kirstein's November 2012 Czechoslovak Air Force theory for the Greifswald Lights, publicly challenged the explanation on strictly evidentiary grounds: documented SAB flare burn times of roughly 22 minutes fell well short of the reported 30-to-60-minute hover durations, and no witness reported the aircraft noise a high-altitude bombing run would ordinarily produce. Kettmann's own position was not that the sighting was anomalous, but that Kirstein's specific solution remained premature and rested on circumstantial rather than verified evidence — a skeptic-on-skeptic critique this site's case file treats as a significant, independent data point.
HA
Active late 1990s–present
Founder & Director, Sirius UFO Space Sciences Research Center
Founder of Turkey's leading private UFO advocacy and research organization and, later, the Istanbul UFO Museum. Akdoğan publicized the Yeni Kent Compound Sighting footage internationally, unveiling it at a Dedeman Hotel press conference and describing it as among the most important UFO images ever captured, showing what he characterized as two occupants' heads — framing this site's own case file treats as considerably more confident than the footage or TÜBİTAK's own hedged findings support. He organized the 2009 International UFO Congress in Istanbul at which the footage was first shown publicly.
PV
Active 1990s–present
Retired Physics & ICT Teacher; Vancouver-Based Technology Columnist
A retired physics and information-technology teacher who has written a long-running Vancouver-based technology column for over three decades, covering AI, scams, media, and digital trends. The first named expert on record (via CHEK News, August 20, 2022) to publicly identify the Vancouver Starlink Satellite Train Sighting, framing its core identification logic: "It just happens to be visually stunning and if you're not aware of what it is, you might indeed say, 'Well, UFO until I know what it is.'"
AD
Active 2010s
Independent Chilean Researcher
Published a ten-page technical report in January 2012 concluding that the most widely circulated 22-minute segment of the Yeni Kent Compound Sighting footage shows light reflecting off the windows of a yacht sailing off the Kumburgaz coast, with the alleged occupant silhouettes explained as the shadows of the vessel's own crew, distorted by extreme digital zoom and low-light conditions.
RL
1935–2014
American Podiatric Surgeon & UFO Researcher
An American podiatric surgeon best known for a separate, widely rejected body of UFO work claiming surgical removal of "alien implants" from self-described abductees. Leir attended the 2009 International UFO Congress in Istanbul and reported personally observing and filming a boomerang-shaped object with visible ports and an alleged "grey" alien silhouette alongside seven to eight other attendees near the Kumburgaz coastline. This site's Yeni Kent Compound Sighting case file treats his involvement as a credibility complication rather than independent corroboration, given the broader rejection of his signature medical claims.
GF
Active 2000s–present
French Skeptical UFO Researcher
A French skeptical UFO researcher who published a 2015 technical analysis of the Yeni Kent Compound Sighting footage, proposing that its core visual signature is a known photographic artifact — an internal lens reflection from a bright, out-of-focus point-source light, of the kind familiar from amateur concert and fireworks photography — with the alleged occupant silhouettes attributed to pareidolia reinforced by prior promotional framing.
Yale University Neurologist; Author, NeuroLogica Blog
A Yale School of Medicine neurologist and prominent science-communication skeptic who published one of the most widely circulated critiques of the El Bosque Air Base UFO video in March 2012, arguing the footage showed only "a small black smudge flying around like an insect" with no usable reference for scale, distance, or speed. He characterized the case as illustrative of a broader "disconnect between what scientists consider good evidence and UFO proponents believe is good evidence."
PB
UFO Author & Skeptical Researcher
A British writer on UFOs and the paranormal, editor of the partwork encyclopedia The Unexplained, longtime contributor to Fortean Times and Magonia, and author of The UFO Casebook (1984) and UFO: The Government Files (1996). On the night of March 30–31, 1993, Brookesmith personally observed lights from the Welsh foothills during the wave later known as the Cosford Incident, initially mistaking them for fast jets before their total silence convinced him otherwise — a rare case of an experienced skeptical UFO researcher becoming a first-hand witness in a case he would go on to help analyze.
Investigator, Devonshire UFO Research Organisation (DUFORO) & BUFORA
A private UFO investigator with the Devonshire UFO Research Organisation and the British UFO Research Association who independently gathered dozens of witness reports from the night of March 30–31, 1993 — including a report relayed to him by South Wales Police of two large bright lights crossing the Bristol Channel — and filed a detailed Interim Report to the Ministry of Defence. In a letter to the MoD dated May 26, 1993, Cooper stated he was already certain the majority of the roughly 1:10 a.m. sightings were of re-entering space debris, anticipating the Cosmos 2238 explanation later confirmed through Gary Anthony's NASA/US Space Command trajectory simulation.
JB
Spanish Journalist & Ufologist
A Pamplona-born journalist and one of Spain's most prolific ufology writers, Benítez received the country's first-ever set of released military UFO files directly from a senior Air Force general in October 1976, publishing them in La Gaceta del Norte that December and, in March 1977, in book form as Ovnis: Documentos Oficiales del Gobierno Español — a compilation that also gave the June 22, 1976 Gando Air Base / Canary Islands UFO sighting its first wide public exposure, nearly two decades before that file's own formal 1994 declassification. Weeks later, he investigated the Talavera la Real sentry encounter directly, publishing "Encounter at Talavera" in the British journal Flying Saucer Review in February 1978 — among the earliest detailed write-ups of the case, predating Spain's later, more systematic 1990s declassification program by nearly two decades.
Researcher, Fundación Anomalía; Co-Author, Poseidon Identification
Co-author, with Vicente-Juan Ballester Olmos, of the March 2001 Revista de Aeronáutica y Astronáutica article formally identifying the June and November 1976 Gando Air Base / Canary Islands UFO sightings as U.S. Navy Poseidon C-3 missile tests. Campo Pérez personally interviewed surviving witnesses decades after the events — including Gen. Dolz Espejo's aide-de-camp, retired Col. Alfonso Ruiz Crespo, in 1995 — and later authored the book El ovni de Gáldar (2023), a detailed case study of the sighting's press coverage, witness testimony, and resolution.
VA
fl. 1988 – 1990s
Naval Officer (Ret.); Director, Sojuzufocenter
A former Soviet naval officer turned prominent ufologist, Azhazha received custody of the KGB's declassified "Blue Folder" — including the Kapustin Yar UAP Sighting file — from Pavel Popovich and became its principal keeper through the 1990s as director of Sojuzufocenter, the first official Soviet public UFO research organization (est. 1990).
AH
fl. 1993 – present
Chilean-American Ufologist & Journalist
A longtime UFO researcher and journalist involved with the Moscow magazine Aura-Z, which published the first English-language excerpts of the KGB's declassified Kapustin Yar UAP Sighting file in March 1993. Huneeus subsequently co-authored, with Don Berliner and Marie Galbraith, the Rockefeller-funded UFO Briefing Document (1995), which reprinted and analyzed the full case for members of the U.S. Congress.
DB
fl. 1960s – 2010s
Aviation Journalist; Director, Fund for UFO Research (FUFOR)
A longtime ufologist dating back to NICAP in the 1960s and later director of the Fund for UFO Research, Berliner led the assembly — with Marie Galbraith and Antonio Huneeus — of the Laurance Rockefeller-funded UFO Briefing Document: The Best Available Evidence (1995), presented to members of the U.S. Congress under the joint imprint of CUFOS, FUFOR, and MUFON. Its detailed analysis of the translated KGB file is the primary English-language source for the Kapustin Yar UAP Sighting.
RP
Founder & President, Centro Ufologico Nazionale (CUN)
Born in Venice in 1944, Pinotti earned a political-science/sociology degree from the University of Florence, served as an Italian Army officer, and wrote for the Air Force's Rivista Aeronautica before founding the Centro Ufologico Nazionale (CUN) in 1967, which he has led since as president and as director of its magazine Notiziario UFO. A leading Italian proponent of the extraterrestrial hypothesis who collaborated with J. Allen Hynek in the 1980s, Pinotti has characterized the Florence Stadium Sighting as "intelligent, technological, and not associated with any known occurrence on Earth," and has specifically rejected the spider-gossamer explanation for the fallen substance as chemically implausible.
MP
Co-Founder & Investigator, CICAP
Born in Voghera on March 10, 1969, Polidoro holds a psychology degree with a thesis on the reliability of eyewitness testimony to unusual phenomena, and has spent more than three decades as co-founder and, for many years, national secretary of CICAP (Comitato Italiano per il Controllo delle Affermazioni sulle Pseudoscienze), Italy's leading skeptical-investigation body. A prolific journalist and longtime contributor to the science magazine Focus, and author of more than fifty books, Polidoro has covered the Florence Stadium Sighting and its chaff-based explanation directly on his own video series, presenting it as an example of how a genuinely mass-witnessed historical event can still have a mundane, chemically verifiable cause.
VG
Researcher, CICAP
A CICAP researcher whose 2014 investigation into the Florence Stadium Sighting proposed that the "bambagia silicea" filaments were military chaff, dispersed during exercises conducted that week in Italian skies by a U.S. Navy carrier air wing — a hypothesis grounded in the near-identical chemical composition (boron, silicon, calcium, magnesium) between standard radar chaff and Professor Giovanni Canneri's original 1954 spectrographic findings, and in both materials' shared tendency to disintegrate readily on contact, unlike protein-based spider silk.
GJ
fl. 2017–present
Independent Investigator, Swansea UFO Network
An independent field researcher with the Swansea UFO Network, Jones began formally investigating Caz Clarke's account of the Pentyrch UFO Incident in October 2017, roughly twenty months after the reported event. He went on to file the great majority of the case's Freedom of Information requests to the Ministry of Defence, the Welsh Government, and Natural Resources Wales, conduct on-site EMF and radiation measurements, co-author the 2021 book with Clarke, and appear as the case's lead investigator in Sky HISTORY's 2022 documentary Craig Charles: UFO Conspiracies. Jones has also authored a separate book on an unrelated Welsh sighting, The Denbigh Lights: A Truthful Argument For The Existence of UFOs.
DZ
Active since 2000
State Director, Missouri Mutual UFO Network (MUFON)
A MUFON field investigator since the early 2000s who has investigated several hundred sighting reports, Ziegelmeyer co-authored, with researcher Margie Kay, the 2023 book 50th Anniversary of the SE Missouri Ozarks UFO Flap and helped coordinate Missouri MUFON's partnership with Piedmont's own 50th-anniversary commemorative festival for the Piedmont Missouri Wave. She received MUFON International's "Field Investigator of the Year" honor and the Roswell Daily Record's "Roswell Incident Excellence Award" in 2017.
RR
Active 1960s
Photographic Adviser, NICAP (National Investigations Committee on Aerial Phenomena)
A professional New York photographer who served for a period as NICAP's early photographic adviser (he later resigned from that role, for reasons not detailed in sources reviewed for this site). In 1964 Rankow examined the original negative behind the Edwards AFB Canberra Photograph, publishing his analysis in NICAP's book The UFO Evidence. He found the discoid shape in the frame's upper-right corner carried a grayscale, shadowed dimensionality inconsistent with a simple scratch or paste-up, while explicitly cautioning that "no photograph…can be considered evidence of UFO reality without a reliable witness" — a case that, notably, never had one. He also flagged later prints supplied by Martin Aircraft Company as showing progressive, suspicious "defacement" of the same corner of the frame.
FS
1924 – 2007
Austrian Foreign Correspondent, Die Presse (Vienna)
An Austrian journalist early in a career that would eventually make him one of Austria's best-known war and crisis correspondents (Angola, Yemen, Chad, Sudan, Cambodia, Afghanistan), Sitte filed the March 29, 1952 Die Presse dispatch that is the sole original source for the Belgian Congo uranium-mine saucer case, including its accompanying — explicitly conjectural — technical sketch of the discs' purported construction. He died of blood cancer in 2007 at age 82.
PG
French Ufologist & Documentation Archivist, ufologie.patrickgross.org
A French former schoolteacher turned IT engineer, born in Mulhouse, Gross began documentation research and field investigation into UFO reports in 1999. His long-running online archive compiles and transcribes original press clippings and case summaries from around the world, cross-referenced by country and date. His catalog entry and transcription of the June 21, 1952 Le Méridional article are the only publicly accessible record of the original press coverage behind the Port-Gentil, Gabon UFO Sighting.
GG
fl. 2014–2016
Canadian Field Investigator, Mutual UFO Network (MUFON)
The volunteer MUFON field investigator assigned to John Sheppard's June 2014 sighting report from Kensington, Prince Edward Island. Genge used the open-source planetarium program Stellarium to rule out stars, planets, and known satellite passes, wrote that the witness's “video and photos are compelling and descriptions are good” despite the limitations of a low-resolution smartphone camera, and closed the case (MUFON Case #57090) as an Unknown rather than attaching any specific conventional explanation — discussed in this site's John Sheppard Sighting case file.
SB
fl. 2014–2016
Assistant Director, Mutual UFO Network of Canada
A former CTV reporter turned MUFON Canada official, Bundy publicly defended the organization's Unknown classification of John Sheppard's June 2014 Kensington, PEI sighting after CBC News solicited skeptical rebuttals in early 2016, stating that “every effort was made to explain” the footage and noting that MUFON's own British Columbia director — also an astronomer and former pilot — did not think the object matched an aircraft on approach. Discussed in this site's John Sheppard Sighting case file.
PG
fl. 2016
Halifax Centre President, Royal Astronomical Society of Canada (RASC)
A 27-year amateur astronomer who has publicly debunked a number of alleged Canadian UFO sightings, Gray proposed to CBC News that the light John Sheppard filmed over Kensington, PEI in June 2014 was most likely a scheduled 11:42 p.m. Air Canada flight on approach to the Îles-de-la-Madeleine airport, roughly 170 km away across the Gulf of St. Lawrence, whose runway alignment he said placed it directly in Sheppard's sightline from the North Shore. Discussed, alongside MUFON's pushback, in this site's John Sheppard Sighting case file.
HM
fl. mid-1980s, 2016
Former Employee, Prince Edward Island National Park
Drawing on his own recollection of military search-and-rescue exercises from his time working at PEI National Park in the mid-1980s, McCormack told CBC News he believed the lights John Sheppard filmed over Kensington, PEI in June 2014 were more likely parachute flares dropped by Canadian military aircraft during a training exercise — a theory Sheppard's own account of hearing aircraft shortly beforehand, and a large military plane overflying the campground the next day, lends some support to. Discussed in this site's John Sheppard Sighting case file.
AF
Active 2004–2008
Pilot and Independent UFO Investigator
A former commercial pilot with extensive flying experience over the Bay of Campeche, Franz proposed that the March 5, 2004 Mexican Air Force FLIR footage recorded the routine gas flares of the Cantarell Field's offshore oil platforms (Akal-C, Akal-J, and Nohoch-A) rather than unidentified craft, and personally flew a September 2004 reconstruction flight along the same approximate heading that captured near-identical infrared "twin" lights from different angles and altitudes, later corroborated by other pilots. His analysis, published between July 2004 and 2008, remains the earliest and most influential independent debunking of the case, later reinforced by satellite and geolocation analysis from Metabunk contributors. Discussed in this site's Campeche Military FLIR Incident case file.
DJ
Active 2020s
Independent Researcher, Scientific Coalition for UAP Studies (SCU)
Filed the Freedom of Information Act request with the NRC that produced the entire internal documentary record — Security Information Database entries, emails, and incident reports — underlying the Palo Verde Nuclear Station Drone Swarm and the broader pattern of 57 drone incursions across 24 nuclear sites nationwide between 2015 and 2019. A separate FOIA request to DHS/CISA was partially denied, with the agency withholding 32 pages under law-enforcement-related exemptions.
AL
Swedish Ufologist; Co-Founder, UFO-Sweden & the Archives for the Unexplained (AFU)
Co-founded UFO-Sweden in 1970 and the Archives for the Unexplained (AFU) in Södertälje in 1973. Assessed Aarno Heinonen's post-1970 "spacewoman" contact claims, which followed the Imjärvi Incident, as resembling mythology and folklore rather than credible continuing testimony, citing the total absence of physical evidence across dozens of later encounters.
DM
Active since 1990s
UFO Researcher & Author; CUFOS Board Consultant
Author of a book-length study of triangular UFO reports and a Center for UFO Studies board consultant, Marler has spent years reconstructing the Farmington case from original 1950 newspaper archives, Project Grudge and AFOSI documents, and James E. McDonald's own 1968 investigative notes held at the University of Arizona. In 2014 he filed a FOIA request that yielded previously redacted AFOSI witness names, and in 2014–15 he personally located and re-interviewed two surviving witnesses, including Marlow Webb. He also traced the famous "V-formation" photograph long misattributed to this case to an unrelated 1950 Irish publication.
FS
1892 – 1964
Variety Columnist & Author
A show-business columnist for Variety whose October–November 1949 columns and 1950 bestseller Behind the Flying Saucers promoted the crashed-saucer story centered on Aztec, New Mexico — sourced to two confidence men posing as scientists and long since discredited as a hoax. Scully's dramatic framing of the Farmington case, quoted at length by skeptic Donald Menzel, described it as "the greatest exhibition of magnetic flight that has ever happened in this universe" — a promotional flourish this site's own research treats as a disclosed credibility concern about the case's popular legacy, distinct from the on-the-record newspaper witnesses themselves.
JG
1926 – 2000
French Ufologist, Science-Fiction Novelist & Investigator; Head of Investigations, Commission Ouranos
Born Henri-René Guieu in Aix-en-Provence, he became, alongside Aimé Michel, one of the pioneering figures of French ufology in the 1950s while heading the investigation service of the Commission Ouranos, one of France's earliest UFO research groups. Guieu personally investigated the Marignane Airport Landing of January 4, 1954, reporting that eleven separate phone calls to airport and police contacts produced only denials and stonewalling, and published his findings in his 1956 book Black-Out sur les Soucoupes Volantes (Fleuve Noir), prefaced by Jean Cocteau.
CV
Journalist, Le Provençal
The Le Provençal reporter who, in the weeks after the Marignane Airport Landing, arranged a direct interview with witness Chesneau — only to find, on arriving at the agreed meeting point, that another fireman redirected him elsewhere and Chesneau never appeared, one of several documented instances of airport staff obstructing outside inquiries into the case.
👁️

Witnesses & Experiencers

462
DN
1913 – 2006
Chief Warrant Officer & Chief Photographer, U.S. Navy
A career Navy photographer with nineteen years of service, a 1935 graduate of the Navy's photographic school, and more than 2,000 hours of aerial-photography experience, Newhouse filmed roughly a dozen bright, disc-shaped objects near Tremonton, Utah on July 2, 1952, while driving with his family from the Washington, D.C. area toward Portland, Oregon. His footage became one of the two most intensively analyzed UFO films of the Cold War era, examined by the U.S. Navy's own Photographic Interpretation Laboratory (which found the objects were not birds, balloons, or aircraft) and by the CIA's Robertson Panel (which concluded they were gulls). Newhouse never wavered from or embellished his account across more than fifty years of periodic interviews, up to his death in Portland in 2006.
NN
Active 1952
First witness to the Tremonton sighting
Born Norma Isobel Strom, and married to Delbert Newhouse since August 7, 1936, Norma was the first family member to spot the objects near Tremonton, Utah on July 2, 1952, and spent nearly a minute convincing her husband to stop the car. She and the couple's two children continued watching the objects with the naked eye for several additional minutes while Delbert retrieved and assembled his camera equipment, giving the family a longer direct observation period than the roughly ninety seconds that ultimately appear on film. Military investigators in 1952 focused almost entirely on Delbert's account, leaving Norma's own extended observation largely undocumented in the official record.
PZ
b. December 28, 1952
Private Security Guard (Guardia Giurata), Istituto di Vigilanza Val Bisagno, Genoa
On night patrol near Torriglia on December 6–7, 1978, Zanfretta reported a close encounter with a nearly three-meter humanoid entity and a triangular craft after his patrol car's engine, lights, and radio failed simultaneously. He went on to report ten further encounters through 1981, the case's central content substantially elaborated through contested regressive-hypnosis sessions. He lost his firearms license and his security career as a direct consequence of the continuing incidents. His case is described by researchers as the most extensively documented alleged contact/abduction case in Italian ufology.
AM
Reported late 1981
Hessdalen Farmers
Local farmers whose late-1981 report of a "burning fireball" crossing the evening sky over Norway's Hessdalen valley is the earliest documented sighting of the modern Hessdalen Lights wave. Their report, followed within days by a cluster of independent sightings from other residents, marks the start of the sustained 1981–84 reporting period that eventually drew formal scientific investigation. Neither had any prior involvement with UFO research or reporting.
Val Bisagno Security Guard
One of the two colleagues dispatched after radio contact with Pier Fortunato Zanfretta was lost on the night of December 6–7, 1978; found him roughly an hour later in shock, disoriented, and unusually warm despite the freezing cold.
Val Bisagno Security Guard
Alongside Walter Lauria, one of the two colleagues who found Pier Fortunato Zanfretta roughly an hour after losing radio contact on the night of his first reported encounter, December 6–7, 1978.
Originator of the Philadelphia Experiment Letters (1955–56)
A merchant seaman whose 1955–56 letters to Morris K. Jessup, claiming firsthand knowledge of a secret Navy invisibility experiment aboard USS Eldridge, are the documented origin point of the entire Philadelphia Experiment legend the U.S. Navy has since explicitly and repeatedly denied. Allen never named T. Townsend Brown in his original letters; that connection was added over two decades later by other authors.
Morris K. Jessup Philadelphia Experiment Case File #192
AV
1934 – 1991
Claimed Abductee, São Francisco de Sales, Brazil
A 23-year-old farmer (later a lawyer) who claimed that on the night of October 15–16, 1957, a circular craft landed in his field near São Francisco de Sales, Minas Gerais, and that he was taken aboard by small humanoid occupants, subjected to what he described as medical procedures including a blood sample, and had sexual contact with a female occupant before being released roughly four hours later. Dr. Olavo Fontes, who had begun investigating the Ubatuba magnesium fragments only weeks earlier, examined Vilas-Boas in 1958 and concluded his reported symptoms were consistent with mild radiation sickness. The full case is examined in this catalogue's dedicated case file.
EK
1903 – 1994
Staff Photographer, O Cruzeiro magazine, Rio de Janeiro
A veteran staff photographer (full name Eduardo Keffel) for Brazil's dominant illustrated weekly O Cruzeiro, credited with shooting the five disputed "flying saucer" exposures at Barra da Tijuca beach on May 7, 1952 with reporter João Martins — the case that launched modern Brazilian ufology. Every subsequent technical investigation, from Donald Menzel and Lyle Boyd's 1963 shadow-direction critique through Claudeir Covo's definitive 2002 on-site reconstruction, identifies Keffel as the images' actual fabricator, using a small model combined with a genuine beach landscape via double exposure. He never issued a full public confession before his death in 1994.
Investigating Officer, Brazilian Air Force (FAB)
A Brazilian Air Force officer who led the FAB's internal 1950s technical review of the Barra da Tijuca photographs, reportedly attempting to reproduce the sequence by throwing a disc-shaped model or pan lid into the air and comparing the resulting motion blur to Ed Keffel's negatives. The review's "cannot rule out authenticity" conclusion was not made public for roughly seven years, and its methodology predates the far more decisive shadow-geometry analysis civilian researchers would apply decades later.
JP
1902 – Mar. 4, 1946
Farmer & Primary Witness, Araçariguama Sighting (1946)
A 44-year-old farmer in Araçariguama, São Paulo state, who returned home from fishing on the Tietê River on the evening of Carnival Monday, March 4, 1946, to find his house empty, his family away at Carnival festivities. Moments after entering to bathe and change, he was struck by what he and later witnesses described as a yellowish beam or flash of light, suffering severe burns from which he died within hours. Family members who reached him before his death recalled him remaining lucid and pain-free, reportedly telling relatives that whatever struck him "was not from this world" and was itself invisible. His death certificate, recovered decades later by researcher Cláudio Tsuyoshi Suenaga, records the official cause as cardiac collapse and generalized first- and second-degree burns. The case went undocumented outside his own family for 25 years until Brazilian ufologists began investigating it in 1971.
AG
20th century
Family Friend & Attending Witness, Araçariguama Sighting (1946)
A family friend with informal nursing experience who was among the first to reach João Prestes Filho after he was burned on March 4, 1946, and who attended him through his final hours, later stating he showed no odor of any combustible fuel and reported no pain despite his condition. Interviewed on tape by APEX researcher Fernando Grossmann on September 28, 1974 — 28 years after the event — her recollection describes flesh visibly separating from bone, a far more severe characterization than other family witnesses' descriptions of "toasted" or "roasted" skin, making her account both the case's most vivid and its most internally disputed piece of testimony.
JV
c.1952 – 2013
U.S. Army Private & Primary Witness, Fort Benning Abduction Case (1977)
A 25-year-old infantry private assigned to Delta Company, 1st Battalion, 1st Infantry at Fort Benning, Georgia in September 1977, who did not consciously recall the event he later described until hypnotic regression beginning around 1991, 14 years afterward. He spent roughly the next decade researching and publicizing the case, co-authoring the self-published book Incident at Fort Benning (2000) with Bruce Stephen Holms and giving numerous radio and media interviews until his death in 2013. Researchers connected to abduction investigator Budd Hopkins interviewed him in person in the early 1990s and ultimately declined to pursue the case further.
JN
c.1955 – Nov. 2011
U.S. Army Sergeant, later Command Sergeant Major; Secondary Witness, Fort Benning Abduction Case (1977)
A buck sergeant (E-5) at Fort Benning in September 1977 who went on to a full Army career and retired as a Command Sergeant Major, Norton did not come forward publicly with his own account of the incident until March 2011, more than 33 years later and only after encountering fellow witness John Vasquez's media appearances. He claimed to have recovered an unverified, never-produced metal fragment bearing unknown markings from the scene. He died in November 2011, roughly eight months after his first public statements, of stated natural causes (cancer and hepatitis C) per the only sources located for this case; no evidence of any connection between his death and his UFO claims was found.
JP
Active 1995
Captain, Aerolíneas Argentinas; Primary Witness, Aerolíneas Argentinas Flight AR674 / Bariloche Incident (1995)
An eighteen-year veteran of Aerolíneas Argentinas, Polanco commanded Flight 674, a Boeing 727 inbound from Buenos Aires, on the night of July 31, 1995, when he reported a maneuvering, structured object pacing his aircraft for roughly seventeen minutes as San Carlos de Bariloche's airport and city lost power below, forcing him to abort his landing. His in-progress radio report to the control tower was preserved in a transcript Argentina's Ministry of Defense declassified in 2020, and he has spent three decades publicly rejecting both the Air Force's official discotheque-spotlight explanation and an independent ski-slope-reflector theory as inadequate to what he personally observed.
RC
Active 1995
Commander, Gendarmería Nacional; Corroborating Witness, Aerolíneas Argentinas Flight AR674 / Bariloche Incident (1995)
A Gendarmería Nacional aircraft commander who, on the night of July 31, 1995, was flying a Piper PA-31T Cheyenne on an unrelated medical-evacuation mission near San Carlos de Bariloche when he independently observed an amber light over Lago Nahuel Huapi that moved at high speed toward the mountains and came to an abrupt stop "sin señales de inercia ni pérdida de control" (with no sign of inertia or loss of control) — an account that echoes Capt. Jorge Polanco's own description of the object's behavior from a wholly separate aircraft and vantage point.
GB
Captain, VASP; Primary Witness, Ceará Boeing 727 Sighting (1982)
A VASP pilot since 1960 with (depending on the source) between roughly 16,000 and more than 26,000 flight hours, Britto commanded VASP Flight 169 on February 8, 1982, when he reported an intensely bright, color-shifting light pacing his Boeing 727 for roughly ninety minutes between Fortaleza and Rio de Janeiro, inviting his approximately 150 passengers to observe it. He had reportedly reported unusual aerial phenomena on three earlier occasions across his career (1964, 1976, 1979), and he never publicly retracted his 1982 account before his death in 2016, despite a detailed peer-reviewed astronomical rebuttal identifying the object as the planet Venus.
Archbishop of Fortaleza, 1973–1995; Passenger, Ceará Boeing 727 Sighting (1982)
A Brazilian Franciscan friar and prelate who served as Archbishop of Fortaleza from 1973 to 1995 and was created cardinal in 1976. Secondary accounts of VASP Flight 169's February 1982 UFO sighting identify him as among the accompanying clergy aboard who declined to look at the reported object, reportedly dozing through most of the ninety-minute observation. Some sources conflate him with his own first cousin, Dom Ivo Lorscheiter, a separate real person who led the National Conference of Brazilian Bishops (CNBB) — a naming confusion this site's case file discloses rather than silently resolves.
RJ
Primary Witness, Delphos, Kansas Ring Sighting
Sixteen years old on the evening of November 2, 1971, Johnson was tending his family's sheep near a grove of trees on their Delphos, Kansas farm when he observed a glowing, mushroom-shaped object hovering roughly seventy-five feet away. He was the sole witness to the object's full approach and stationary hover before running to alert his parents, and reported temporary eye irritation and nightmares in the days that followed. He never materially altered his account across more than five decades of interviews.
KW
fl. 1967
Truck driver; civilian witness, Belt, Montana
Reported that a domed object paced his truck at 40–50 mph near Belt, Montana in the early hours of March 24, 1967, before descending into a nearby canyon. Williams stopped and approached on foot; he described the object emitting an intensely bright light that briefly blinded him before it rose "like a bolt of lightning" and vanished. His report, filed the same night as the Oscar Flight missile shutdown roughly 40 miles away, was investigated by Project Blue Book field officer Lewis Chase, who found broken brush at the site but reported the search's outcome as "negative results."
RN
Primary Witness, Trans-en-Provence Sighting
A 55-year-old retired mason living on a disability pension since a 1973 heart condition, Nicolaï was working on a masonry water-pump enclosure on his property's terrace in Trans-en-Provence, France on January 8, 1981 when he observed a lead-gray, saucer-shaped object descend, hover briefly, and depart. He reported the sighting to the gendarmerie the next day, reportedly suspecting a secret military device; investigators who interviewed him directly assessed his credibility as sound. He gave few subsequent public interviews.
FD
Primary Witness (age 13½), Cussac Close Encounter
The son of Cussac's mayor, François was watching the family's cattle at the Les Tuiles pasture on August 29, 1967 when he and his sister Anne-Marie Delpeuch reported four small black humanoid figures boarding a hovering metallic sphere. He gave formal, separately-conducted accounts to investigators three times across more than a decade — 1967–68, 1977, and 1978 — and his core testimony never changed, though he consistently and voluntarily noted he never personally saw the support legs his sister described beneath the craft.
AD
Primary Witness (age 9), Cussac Close Encounter
The younger sister of François Delpeuch, Anne-Marie was watching the family's cattle alongside him at Cussac's Les Tuiles pasture on August 29, 1967 when the two witnessed four small black humanoid figures near a hovering metallic sphere. Interviewed separately from her brother from the outset, she independently corroborated the core sighting while also describing support legs beneath the craft that François said he never saw — an honestly preserved discrepancy between the two witnesses.
Corroborating Witnesses (Ronald Johnson's Parents), Delphos, Kansas
Alerted by their son Ronald, Durel and Erma Johnson reached the pasture in time to see the object climb rapidly and depart. Together the family discovered the glowing soil ring afterward; Erma directly handled the ring material and reported her fingers going numb on contact, a symptom that reportedly persisted for roughly two weeks. Neither parent witnessed the object's earlier stationary hover.
RT
1918 – 2007
Forester, Livingston Development Corporation
A 61-year-old forester with roughly fifteen years' experience, Taylor was checking fences and young trees with his dog Lara on the morning of November 9, 1979 when he encountered a large spherical object and two smaller spiked spheres in a clearing on Dechmont Law near Livingston, Scotland. He was found later that morning with torn trousers, facial and leg grazes, and no memory of roughly twenty minutes. A World War II veteran and teetotal churchgoer with no history of seeking publicity, he never altered his account before his death in 2007, and Lothian and Borders Police opened a genuine assault investigation into his injuries.
PT
1908 – 1998
Farmer; Photographer, McMinnville, Oregon
Tenant dairy farmer near McMinnville, Oregon who, on the evening of May 11, 1950, retrieved his household's wife Evelyn's loaded Kodak/Universal Roamer camera and took the two photographs of a metallic disc that became known as the McMinnville UFO photographs, published nationally by LIFE magazine. He declined every offer of payment for the pictures and maintained they were genuine until his death in 1998.
ET
1919 – 1997
Farmer; Primary Witness, McMinnville, Oregon
First to spot the metallic, disc-shaped object while feeding rabbits behind her farmhouse near McMinnville, Oregon on May 11, 1950. She called her husband Paul outside with the camera, and her account of the object's silent, gliding departure to the west became the core narrative behind one of the most reproduced UFO photographs in history. She never altered her account of the sighting before her death in 1997.
HC
active 1952
Air Traffic Controller, Washington National Airport Tower
Watched a hovering light depart at extraordinary speed from the tower window in tandem with a radar disappearance on July 19–20, 1952. Fifty years later, told the Washington Post his account had not changed: "I saw it on the [radar] screen and out the window."
GG
1923 – 1982
Pilot, 178th Fighter Squadron, North Dakota Air National Guard
A founding officer of the North Dakota Air National Guard, Gorman spent 27 minutes pursuing a small, blinking, round light over Fargo on October 1, 1948, attempting to ram it head-on and chasing it to a stall-inducing 14,000-plus feet. His certified statement — "I am convinced that there was definite thought behind its maneuvers" — remains the case's central document. He retired a lieutenant colonel in 1969 and died in 1982, reportedly still privately unconvinced by the Air Force's balloon explanation.
LJ
active 1948
Air Traffic Controller, Hector Airport Tower
Tracked the October 1, 1948 pursuit through binoculars from the Hector Airport tower alongside fellow controller H.E. Johnson, independently confirming the object consistently outdistanced Lt. George Gorman's fighter. His written statement is among the case's primary Project Blue Book source documents.
HJ
active 1948
Air Traffic Controller, Hector Airport Tower
Watching alongside Lloyd Jensen, Johnson described the object as "traveling at a high rate of speed" and fast enough to "increase the spacing between itself and [Gorman's] fighter" — an independent, real-time ground assessment matching Gorman's own account.
AC
active 1948
Pilot, Piper J-3 Cub
A local optician and licensed private pilot with no prior connection to Gorman, Cannon was flying his own Piper Cub roughly 500 feet below the pursuit with a passenger aboard. His unprompted, independent confirmation that the object was moving "much faster than the 51" is one of the case's strongest corroborating details.
Pilot, Capital Airlines Flight 807
Visually confirmed six radar-called targets over a fourteen-minute radio exchange with controller Harry Barnes on July 20, 1952 — the case's single most scientifically significant data point, a live, two-way radar-visual correlation.
JG
active 1952
Retired Army Artillery Officer; Civilian Witness, Alexandria, VA
Reported a red, cigar-shaped object comparable in size to a DC-7 airliner during the 1952 Washington flap, its side marked by a row of closely spaced lights. Stated a neighbor employed by the FBI independently witnessed the same object.
KT
Captain, JAL Cargo Flight 1628 (age 47 in 1986)
A JAL veteran and former Japan Air Self-Defense Force fighter pilot with roughly 29 years of flying experience, Terauchi was the primary witness of the November 17, 1986 Japan Air Lines Cargo Flight 1628 encounter over Fort Yukon, Alaska, describing two escort objects and a giant "mothership." FAA investigators assessed him as rational and credible, though his own history of prior and subsequent similar reports led the agency to later call him a "UFO repeater." Grounded by JAL for speaking to the press without authorization, he was later fully reinstated to flying status.
First Officer, JAL Cargo Flight 1628 (age 39 in 1986)
Corroborated the presence of unusually luminous lights during the Japan Air Lines Cargo Flight 1628 encounter, but offered a more cautious account than Captain Terauchi, telling investigators the lights did not appear meaningfully different from ordinary stars when asked directly, and separately rejecting a proposed "weather interference" explanation on the grounds that the sky that night was clear.
Flight Engineer, JAL Cargo Flight 1628 (age 33 in 1986)
Reported clusters of lights he compared to the illuminated windows of a passenger aircraft during the Japan Air Lines Cargo Flight 1628 encounter, and identified a large primary contact on the aircraft's own weather radar roughly seven to eight nautical miles ahead. By his own later characterization, he remained uncertain whether what he observed constituted a "UFO."
AB
Active since 1980
USAF Security Police Officer
Former Security Police patrolman at RAF Woodbridge who reported being present during the third night of the Rendlesham Forest encounter. He corroborated aspects of the military cordon and visual reports of the anomalous craft, later providing details on the security response.
GG
Guy G.
Active since 1994
Ariel School Witness
One of the older children at Ariel School during the 1994 incident. He provided highly articulate descriptions of the landing, the silver disc, and the entities' physical features, particularly their large, black slanted eyes, and recalled a telepathic warning about unchecked technology.
CE
Active since 1970s
Navajo County Deputy Sheriff
The first law enforcement officer to meet the Rogers logging crew at the forest boundary on the night of November 5, 1975. He testified that the men were in a state of severe, unsimulated shock and panic, which prompted him to immediately contact Sheriff Gillespie.
MG
Active since 1970s
Navajo County Sheriff
The sheriff who led the five-day search and potential homicide investigation into Travis Walton's disappearance. Gillespie initially treated the crew as suspects but eventually accepted their account after they passed Cy Gilson's polygraph tests, defending their credibility in subsequent interviews.
DW
Active since 1975
Duane Walton (Brother of Travis)
Travis Walton's older brother who coordinated his rescue from the Exxon gas station pay phone in Heber on November 10, 1975, and acted as the family's primary spokesperson. He was instrumental in arranging Travis's medical examinations with APRO.
CB
Experiencer; author of UFO of God
Reported a dramatic UAP/entity encounter in 2007 along the Cape Fear River, North Carolina. Was contacted by Tim Taylor "The Dragon" after publishing his account. Has undergone extensive investigation by both civilian researchers and intelligence community figures. Notable for the ongoing nature of his reported experiences and the caliber of people who have investigated them. Full case history, including MUFON's mixed polygraph findings and two independently debunked 2025 videos, is documented in this site's dedicated case file.
GM
Hacker; breached 97 U.S. military & NASA computers
Hacked into Pentagon and NASA systems (2001–2002) searching for UFO evidence and free energy technology. Claims to have found a list of "Non-Terrestrial Officers" and "fleet-to-fleet transfers" — suggesting a secret space program. Faced extradition to the U.S. (up to 70 years) but was blocked by UK Home Secretary in 2012 on human rights grounds.
NASA Pentagon Secret Space Program
TT
Tim Taylor "The Dragon"
Aerospace insider; extensive security clearances
Identified as "Tyler D." in Diana Pasulka's American Cosmic. Holds extensive security clearances across multiple government agencies. Took Garry Nolan and Diana Pasulka to a purported crash site in New Mexico. Contacted Chris Bledsoe after the publication of UFO of God. One of the most mysterious connectors between scientific, intelligence, and experiencer communities in modern UAP research.
Sighting Witness (2007); framing subcontractor
One of three framing subcontractors present at Chris Bledsoe's January 2007 fishing trip. Gave MUFON investigators an account of the orange lights and larger luminous object substantially consistent with the other witnesses.
Sighting Witness (2007); framing subcontractor
One of three framing subcontractors present at Chris Bledsoe's January 2007 fishing trip, independently corroborating the group's account of the sky objects to MUFON investigators.
Sighting Witness (2007); framing subcontractor
One of three framing subcontractors present at Chris Bledsoe's January 2007 fishing trip, independently corroborating the group's account of the sky objects to MUFON investigators.
Wife of Chris Bledsoe Sr.
Married to Chris Bledsoe throughout the events described in this case file. The 2007 encounter and its aftermath placed significant strain on the marriage, which both have said has since endured.
RB
Son of Chris Bledsoe Sr.; host, Bledsoe Said So
Hosts the video podcast Bledsoe Said So, built around the family's continuing UAP experiences following his father Chris Bledsoe's 2007 encounter, and has become a public voice for the family's ongoing account.
Daughter of Chris Bledsoe Sr.
Has given public interviews describing her own encounters, which she says began around age ten, following her father Chris Bledsoe's 2007 encounter, and shares her account publicly under the handle "bledsoebaby."
JB
USAF veteran; self-described UAP retrieval whistleblower
Emerged publicly in January 2025 in an interview with Ross Coulthart on NewsNation, claiming to have participated in a secret government UAP retrieval program. Alleged involvement in the recovery of a "white, egg-shaped" non-human craft. Co-founded Skywatcher Technologies for UAP detection. His military background and claims are debated within the UAP community.
Crash Retrieval Ross Coulthart Skywatcher
MB
~1899 – 1963
Rancher; discovered the Roswell debris
Foreman of the J.B. Foster Ranch, 75 miles NW of Roswell. Discovered unusual debris in his pasture in mid-June/early July 1947 and reported it to Sheriff George Wilcox, triggering the chain of events that became the Roswell Incident. Was held incommunicado by the military for approximately one week; his story changed dramatically after military custody.
Roswell Jesse Marcel
JM
Jesse Marcel Jr.
1936 – 2013
Son of Major Marcel; Army Colonel, Flight Surgeon
At age 11, handled the Roswell debris. Described I-beam members with purple hieroglyphic symbols and unusual metallic foil. Became a medical doctor and Army Colonel. Authored The Roswell Legacy. His military career and consistent testimony make him one of the most credible Roswell witnesses.
Roswell Debris Witness The Roswell Legacy
GD
1925 – 2015
Mortician, Ballard Funeral Home, Roswell
Claimed to receive calls from Roswell base about small caskets and body preservation. A nurse allegedly confided about an alien autopsy. However, Dennis provided a fictitious name for the nurse. Co-founded the International UFO Museum, giving him financial interest. Credibility seriously compromised.
Roswell Alien Autopsy UFO Museum
TL
active 1997
Key witness of the Phoenix Lights Event One
Observed the massive V-shaped craft pass directly overhead at close range in North Phoenix alongside his family, confirming the object was a single solid craft that blocked the stars.
Phoenix Lights V-Formation
MF
active 1997
Former police officer, pilot, Chandler resident
Eyewitness to the Phoenix Lights Event One, providing detailed size and flight characteristics of the silent V-shaped craft which he described as moving like a whale swimming through the air.
BG
active 1997
Cement truck driver, witness
Witnessed two glowing orange spheres that were approached by scrambled military jets from Luke AFB, which the spheres easily outmaneuvered by performing a silent vertical climb.
Phoenix Lights Luke AFB Intercept
KR
Civilian pilot, actor
Reported the Phoenix Lights V-formation to air traffic control while landing his private aircraft at Sky Harbor Airport with his son Oliver on the evening of March 13, 1997.
BL
b. 1959
Whistleblower; S-4 claimed researcher
Broke the S-4 / Area 51 story on KLAS-TV in 1989 with George Knapp, claiming to have worked on reverse-engineering nine alien discs. Described the "Sport Model" and claimed propulsion was powered by Element 115. His story is highly controversial, but introduced Area 51 to global pop culture.
Lazar / S-4 Area 51 George Knapp John Lear Element 115
BH
1919 – 2004
Abductee, social worker, researcher
Co-subject of the first widely publicized UAP abduction in New Hampshire (1961). Drew the famous "star map" under regressive hypnosis, later analyzed by Marjorie Fish as pointing to the Zeta Reticuli system. Spent her life studying UAP and writing.
Betty & Barney Hill Abduction Zeta Reticuli
BH
1922 – 1969
Abductee, civil rights activist, postal clerk
Co-subject of the 1961 New Hampshire abduction. Under regressive hypnosis with Dr. Benjamin Simon, recalled physical examinations by beings with large eyes. His accounts provided foundational imagery for the modern "Grey" alien archetype.
Betty & Barney Hill Abduction Dr. Benjamin Simon
HS
1945 – 2017
Patrolman & Police Chief, Ashland, Nebraska; U.S. Navy veteran
Reported a landed/hovering disc on Highway 6/63 near Ashland, Nebraska on December 3, 1967, discovering ~20 minutes of missing time and a red welt on his neck. Under February 1968 hypnosis by Dr. Leo Sprinkle for the Condon Committee, described being taken aboard by humanoid beings and communicating telepathically. Passed a polygraph; the Committee itself concluded it had "no confidence" the experience was physically real.
CH
1935 – 2022
Oil Rig Foreman; U.S. Air Force Veteran (Korean War)
A 41-year-old oil-well driller with 15 years' experience "in the patch" around Rawlins, Wyoming, Higdon reported meeting a humanoid entity calling itself "Ausso One" while elk hunting in the Medicine Bow National Forest on October 25, 1974, and described a subsequent journey aboard a transparent cube-shaped craft. Found disoriented in his truck, three miles from where he had parked, he underwent hypnotic regression with Dr. Leo Sprinkle and passed a polygraph arranged by the National Enquirer. He maintained the same core account for the rest of his life, retiring from oilfield work in 1997 and dying in Temple, Texas on January 26, 2022.
MH
fl. 1974 – 2017
Wife of Carl Higdon; Author
Reported, with friends Don and Marilyn James, a red-green-white flashing light moving back and forth over the search area on the night her husband Carl Higdon went missing, October 25, 1974 — the only corroborating observation by a second party anywhere in the case, though it does not independently confirm the humanoid encounter itself. Decades later she authored Alien Abduction of the Wyoming Hunter (2017), a first-person family account of the case and its long aftermath.
LS
fl. 1976
Driver; Casey County Extension Office Assistant
A 44-year-old widow who had raised two children alone and sang gospel with the Jubilee Echoes, Smith was driving her newly-purchased 1967 Chevrolet Nova on Kentucky Highway 78 near Stanford on January 6, 1976 when she and her two passengers reported a domed, disc-shaped object descending onto the road ahead of them, followed by roughly eighty minutes of missing time. Smith discovered a burn-like mark on her own neck matching her friends', found her car's hood paint bubbled and its lights inoperative, and later reported unexplained electrical anomalies at home and the sudden, sustained terror of her own pet parakeet. She passed a July 1976 polygraph examination and underwent hypnotic regression with Dr. R. Leo Sprinkle.
MS
Front-Seat Passenger; Former Arts & Crafts Shop Owner
Turning 36 on the night of the encounter, divorced and doing secretarial work for her father, Stafford was riding in Louise Smith's car near Stanford, Kentucky on January 6, 1976 when the three women reported a close encounter with a disc-shaped object and roughly eighty minutes of missing time. She was the first of the three to consent to hypnotic regression with Dr. R. Leo Sprinkle, and under later sessions produced the case's most detailed account of an onboard medical examination by several short, masked humanoid figures. She suffered severe conjunctivitis in the encounter's aftermath and passed a July 1976 police polygraph examination.
ET
Rear-Seat Passenger; Housewife
A 48-year-old lifelong Casey County resident married to Otis Thomas, Elaine Thomas was riding in the back seat of Louise Smith's car near Stanford, Kentucky on January 6, 1976 during the reported encounter and missing-time episode. Under hypnotic regression with Dr. R. Leo Sprinkle, she recalled being examined by four-foot-tall, grey-skinned humanoid figures and a device placed around her neck. She passed a July 1976 police polygraph examination alongside her two companions.
LL
fl. 1976
Liberty, Kentucky Neighbor
A Liberty neighbor of Louise Smith, Mona Stafford, and Elaine Thomas, Lee independently corroborated the women's account of the missing-time discrepancy from his own observations that night, and separately noted that all three women, questioned apart from one another, produced strikingly similar sketches of the entities they described.
VJ
Active 1979
Deputy Sheriff, Marshall County, Minnesota
On overnight patrol near Stephen, Minnesota on August 27, 1979, Johnson reported an intense light that struck his patrol car, leaving him unconscious for roughly 39 minutes with eye injuries resembling welder's burns and a shattered windshield outside technicians could not conventionally explain. Both his wristwatch and the cruiser's dashboard clock — which he meticulously synced every shift — had stopped at the same 14-minute offset. He never claimed to have seen a craft, declined a formal polygraph, and largely withdrew from public comment after the ensuing national media frenzy.
DB
Active 1979
Sheriff, Marshall County, Minnesota
Led the Marshall County Sheriff's Office's formal investigation into Deputy Val Johnson's August 27, 1979 encounter and publicly vouched for his deputy's sobriety and character, stating: "I know Val, and if he said it happened, it happened."
ED
Chief Deputy, Marshall County Sheriff's Office
Corroborated Sheriff Dennis Brekke's character assessment of Val Johnson, describing him as almost "annoyingly" fussy about his patrol log and timekeeping — testimony directly relevant to weighing the synchronized 14-minute stoppage of Johnson's watch and the cruiser's dashboard clock.
KA
1915 – 1984
Civilian pilot, businessman
Reported nine saucer-like objects flying in formation near Mount Rainier on June 24, 1947. Described their motion as "skipping like a saucer would across water" — which the media misreported as "flying saucers," launching the modern UFO era just weeks before Roswell.
Kenneth Arnold Mount Rainier First Sighting
HD
active 1947
Harbor patrol officer; Maury Island witness
Tacoma harbor patrolman who claimed six doughnut-shaped craft hovered over his boat near Maury Island, WA, on June 21, 1947, dropping slag that killed his dog and injured his son. Claimed a "man in black" warned him to silence the next day. The FBI's 1947 investigation concluded the story was fabricated; Dahl himself hedged that he would call it a hoax if formally pressed, without ever fully retracting it.
TW
Abductee, author of The Walton Experience
Arizona forestry worker who disappeared for five days after being struck by a beam of energy from a hovering metallic disc in the Apache-Sitgreaves Forest. His case is one of the most famous abduction stories in history, supported by five fellow logging crew members who passed polygraph tests. His story was adapted into the 1993 film Fire in the Sky.
MR
active 1975
Crew boss, logging contractor, investigator
Contracted by the U.S. Forest Service. Led the seven-man crew that witnessed the hovering UAP at Turkey Springs and saw Travis Walton struck by the energy beam. Maintained Walton's truthfulness under police pressure and later initiated tree-ring core studies at the site.
Travis Walton Case Turkey Springs Tree Rings
JG
Forestry crew member, witness
Member of the wood-thinning crew who witnessed the hovering disc and the beam of energy that struck Travis Walton. Passed Cy Gilson's polygraph examination in November 1975, stating he saw the UAP and did not harm Walton.
Travis Walton Case Polygraph
SP
active 1975
Forestry crew member, witness
Member of the wood-thinning crew who witnessed the hovering disc and the beam of energy that struck Travis Walton. Consistently maintained the reality of the encounter despite police pressure. Passed Cy Gilson's polygraph examination in November 1975.
Travis Walton Case Polygraph
AD
Forestry crew member, witness
Member of the wood-thinning crew who witnessed the UAP at Turkey Springs. Had a history of friction with Walton, leading police to suspect him of foul play. Walked out of the initial November 10, 1975 polygraph test, though he later passed a re-test in 1993 administered by Cy Gilson.
Travis Walton Case Polygraph
ET
active 1994
Ariel School witness, artist
Witnessed the landed silver disc and beings in Ruwa, Zimbabwe at age 8. Recalled standing close to the entities and receiving a telepathic warning of environmental destruction and technology dependency. Expressed the trauma of her experience through abstract artwork in adulthood.
Ariel School Telepathy John Mack
SS
active 1994
Ariel School witness, human rights advocate
Witnessed the landed silver disc and beings in Ruwa, Zimbabwe at age 10. Described a feeling of overwhelming terror and receiving non-verbal warnings about human mistakes. Stated the experience shaped her career in human rights and social justice.
Ariel School John Mack
LF
active 1994
Ariel School witness
Witnessed the landed silver disc and entities in Ruwa, Zimbabwe at age 8. Described the entities' slow-motion gliding movements as highly unnatural. Maintained the uncorrupted clarity of her memories decades later in the documentary Ariel Phenomenon.
Ariel School John Mack
LH
active 1994
Ariel School witness
Pupil at the Ariel School who witnessed the UAP landing. Lacking prior concepts of extraterrestrials, she and other local Shona children initially feared the entities were tokoloshes (folklore dwarf-demons), leading to schoolyard panic. Verified the physical reality of the event as an adult.
Ariel School Folklore
SM
1916 – 1999
Prospector, industrial mechanic, witness
Encountered two disc-shaped craft in Whiteshell Provincial Park, Manitoba, on May 20, 1967. Approached the landed craft, which suddenly departed, releasing a blast of hot gas from a grid-pattern exhaust vent that burned a grid of circular holes into his chest and shirt. His physical injuries and soil radiation anomalies were investigated extensively by Canadian authorities.
Falcon Lake Grid Burns Radiation
FR
b. ~1935
Civilian Witness — Roswell, 1947
Daughter of Roswell Fire Department Crew Chief Dan Dwyer. Twelve years old in 1947, Rowe was present at her father's fire station when a state trooper displayed a fragment of the recovered debris. Her account is among the most vivid: the material was lightweight and "flowed like quicksilver" on a table before snapping back to its original shape without a crease. She also testified that a man in plain clothes visited the Dwyer home and warned the family they could be "taken out into the desert and never be found" if they spoke.
roswellwitnesses1947
DD
d. ~1969
Crew Chief, Roswell Fire Department — 1947
Crew Chief of the Roswell Fire Department in 1947. According to his daughter Frankie Rowe, Dwyer responded to a crash site call outside city limits and allegedly witnessed a downed craft and small, non-human figures among the wreckage. Fire department logs confirmed his employment and out-of-city emergency responses. He reportedly never discussed the incident publicly.
roswellwitnesses1947military
Civilian Witness — Roswell, 1947
One of Mac Brazel's nearest neighbors northwest of Roswell. On approximately July 5, 1947, Brazel brought debris samples to the Proctor ranch before reporting to the sheriff. Loretta described the material as lightweight, smooth, and impossible to cut with a knife or burn with a match — consistent with multiple other witnesses. She and Floyd encouraged Brazel to report the find to authorities.
roswellwitnesses1947
Civilian Witness — Roswell, 1947
Neighbor of Mac Brazel on the ranches northwest of Roswell. Floyd also handled and examined the debris when Brazel brought samples to the Proctor ranch around July 5, 1947. The Proctors encouraged Brazel to report to the authorities — a decision that set the entire Roswell incident in motion.
roswellwitnesses1947
Sheriff, Chaves County — 1947
The Chaves County Sheriff who received Mac Brazel's initial debris report on July 6, 1947, and immediately relayed it to Roswell Army Air Field. His granddaughter Barbara Dugger later stated that Wilcox told his family the military had threatened him and his family with death if he ever discussed the incident. He reportedly never spoke about Roswell again and did not seek re-election.
roswellwitnesses1947government
Asst. Flight Safety Officer, RAAF — 1947
Assistant Flight Safety Officer at Roswell Army Air Field in 1947. Shirkey stated he personally witnessed debris being loaded onto a B-29 for transport to Fort Worth on July 8, 1947, and saw personnel including Jesse Marcel carrying boxes of unusual material to the aircraft — providing independent corroboration of the physical transfer of materials from RAAF.
roswellwitnesses1947military
Civilian Witness — Roswell, 1947
Daughter of Mac Brazel. Present when her father returned to the Roswell debris field around July 4, 1947, Bessie later described the material as including foil-like metal, small sticks, and a tough parchment-like paper. Her descriptions have been cited by skeptics as consistent with Project Mogul materials, though the family's account of Mac Brazel's behavior afterward suggests the incident held more weight than he publicly acknowledged.
roswellwitnesses1947
Alleged Roswell Witness — Plains of San Agustin
A soil conservation engineer from Socorro, New Mexico, who allegedly claimed to have encountered a crashed disc and small non-human bodies on the Plains of San Agustin in summer 1947. His account was relayed after his death in 1969 by friends Vern Maltais and Harold Baca. Because Barnett cannot be questioned and the account is third-hand, it is classified as unverified testimony. Most researchers have shifted the proposed second crash site much closer to the Foster Ranch.
roswellwitnesses1947unverified
FK
DISCREDITED — Roswell Claimed Witness
Claimed to be a military witness who directly observed the Roswell crash and recovered alien bodies. His testimony was heavily relied upon by early researchers including Kevin Randle and Donald Schmitt. After his death in 2001, forged military documents were discovered in his personal files and key claims were proven fabrications. His inclusion forced significant published retractions. DEBUNKED — a cautionary example of how fabricators contaminate historical investigations.
roswellwitnessesdiscrediteddebunkedhoax
DISCREDITED — Roswell Claimed Child Witness
Claimed he was five years old when his family encountered a crashed disc and small non-human bodies on the Plains of San Agustin in 1947. His account emerged in the early 1990s after TV coverage. Significant inconsistencies were found across his interviews and he could not corroborate key details. Most Roswell researchers — including those sympathetic to the broader case — have dismissed his account. DISCREDITED.
roswellwitnessesdiscredited
CONTESTED — Roswell Claimed Witness
Claimed he and Trudy Truelove witnessed a craft crash into a cliff face 55 miles north of Roswell (Hub Corn Ranch / Huber Ranch) while camping. His account was central to the "Skip/Bounce" site debate. Later discredited by signing conflicting 1993/1995 affidavits and attempting to sell "crash debris."
roswellwitnessescontested
KSWS Radio Teletype Operator, Roswell
KSWS radio employee who attempted to transmit the initial civilian reports of the Roswell crash to the Associated Press wire on July 8, 1947. She testified that the transmission was abruptly cut off by an incoming FBI/FCC wire warning to cease transmission under penalty of losing the station's license.
roswellwitnessesmedia
KSWS Radio Station Co-owner, Roswell
Co-owner of Roswell's KSWS radio station who was present on July 8, 1947 when the teletype machine actively transmitting the crash wire was interrupted by federal authorities. Shortly after, military police arrived to confiscate the scripts.
roswellwitnessesmedia
KGFL Radio Announcer and Reporter, Roswell
KGFL radio announcer who received the initial press release from Walter Haut and sent it to the United Press wire. Joyce testified that he spoke with Mac Brazel and later received threatening calls from Pentagon officials ordering him to cease broadcasting the story.
roswellwitnessesmedia
DISCREDITED — Petit-Rechain Photo Hoaxer
The man behind the most famous photograph of the Belgian UFO Wave. In April 1990, Maréchal claimed to have photographed the underside of a triangular craft from his balcony in the village of Petit-Rechain, near Verviers. The photograph became the defining visual icon of the wave and was analyzed by the Belgian Royal Military Academy and SOBEPS, neither of which conclusively identified tampering at the time. In July 2011, Maréchal came forward on Belgian television (RTL) and confessed that the photo was a hoax: he had carved a triangle from Styrofoam, painted it black, fitted it with flashlights and colored filters, and photographed it suspended from a string — as a prank on coworkers. COBEPS (SOBEPS successor) accepted the confession. The photo is DEBUNKED. Its exposure illustrates why photographic evidence alone cannot anchor a case; the 2,600+ corroborating reports, radar data, and official military testimony remain unaffected.
belgian-wavewitnesseshoaxdiscreditedPetit-RechainphotographdebunkedBelgium19902011
BC
1929 – 1998
Primary Witness, Cash-Landrum Sighting
A local business owner who was driving the vehicle during the December 29, 1980 encounter near Huffman, Texas. Having exited the car to observe the diamond-shaped craft directly, she experienced the most severe physical effects, including intense skin blistering, swelling, gastrointestinal distress, and massive hair loss. She was hospitalized under sterile conditions at Parkway Hospital in Houston. Her medical records became central to the $20 million lawsuit against the U.S. government. She passed away exactly 18 years to the day after the incident.
Cash-Landrum Cash-Landrum Sighting
VL
1923 – 2007
Primary Witness, Cash-Landrum Sighting
A passenger in Betty Cash's vehicle during the 1980 encounter. She remained inside the car for most of the event to protect her grandson Colby. Landrum touched the vinyl dashboard which had softened from the craft's extreme radiative heat, leaving a permanent handprint. She suffered from hair loss, skin lesions, and subsequently developed severe cataracts that required surgery. She was a co-plaintiff in the historic CAUS-led federal lawsuit against the U.S. government.
Cash-Landrum Cash-Landrum Sighting
CL
Child Witness, Cash-Landrum Sighting
Grandson of Vickie Landrum, Colby was only seven years old when he witnessed the glowing diamond-shaped craft on FM 1485. He experienced severe terror during the encounter and subsequently suffered from skin irritation, hair loss, and eye swelling. As one of the three primary witnesses, his childhood testimony remained consistent throughout the subsequent MUFON, DAIG, and media investigations of the case.
Cash-Landrum Cash-Landrum Sighting
Director, Colares Health Clinic (1977)
The primary medical physician and director of the municipal health unit in Colares during the late 1970s. Dr. Carvalho clinically treated over 120 patients who had been targeted by the chupa-chupa light beams. She documented physical injuries resembling radiation burns, necrosis, and unique micro-puncture wounds accompanied by severe anemia. She famously refused orders from military intelligence officers to attribute the injuries to mass hallucination or hysteria.
Colares Clinic Colares / Operation Prato
Mayor of Colares (1977)
The Mayor of the Colares municipality during the peak of the UFO wave. Faced with mounting panic, armed civilian patrols, and the rapid emigration of hundreds of residents who fled the island, Soeiro took the official step of writing a formal letter to COMAR-I in Belém requesting immediate military intervention. This request was the direct catalyst for the launch of Operação Prato.
First Crash Witness
A local resident who witnessed a bright, glowing object land in the woods near her home. She was the first to call WHJB radio and the State Police, reporting a fallen "four-pointed star" that had ignited a small brush fire in the ravine, triggering the search.
First Witness Kecksburg Sighting
Acorn Object Eyewitness
A local resident who witnessed the object glide slowly over the treetops, bank sharply, and settle into the ravine. He walked down into the woods and stood next to the acorn-shaped craft, describing its bronze color and the raised ring around the base containing runic markings.
Eyewitness Kecksburg Sighting
Acorn Object Eyewitness
A local youth who entered the ravine shortly after the object landed. He observed the metallic acorn craft glowing with a faint blue light in the dark woods. He described the lack of standard wings or propulsion exhaust before being escorted out by military police.
Eyewitness Kecksburg Sighting
Reporter, Los Angeles Herald-Examiner
An on-duty journalist who witnessed the blackout engagement on February 25, 1942. Jenkins reported seeing a formation of approximately 25 silver, V-shaped objects flying slowly and silently over Santa Monica and Long Beach, unaffected by direct anti-aircraft shell detonations.
Reporter Battle of LA
WH
Columnist, Los Angeles Times ("By the Way")
A prominent Los Angeles Times columnist (1939–1971) who witnessed the engagement. A prior version of this bio described him observing a large glowing object — the opposite of his actual account: Henry, along with Scripps-Howard columnist Ernie Pyle, wrote emphatically that he never made out any aircraft at all during the barrage, making him one of the incident's notable skeptical witnesses.
Columnist Battle of LA
LK
b. ~1947
Physician, Lead Witness / Filmmaker
Filmed key video of the Phoenix Lights in March 1997. She became a chief advocate for researching the case and authored "The Phoenix Lights" book and documentary.
NY
Imperial Iranian Air Force F-4 Pilot
Scrambled to intercept the luminous UAP over Tehran on September 19, 1976. Reported instrument failure, communication loss, and anomalous flight maneuvers as his jet approached the craft.
Pilot Tehran 1976
YN
Yadollah Nazeri (Yaddi)
b. ~1946
Imperial Iranian Air Force F-4 Pilot
Pilot of the second F-4 fighter jet scrambled to intercept the Tehran UAP. Confirmed the primary object's large size, brilliant colors, and high-speed acceleration away from his intercept route.
Pilot Tehran 1976
JD
Imperial Iranian Air Force F-4 RIO
Backseat radar operator scrambled during the Tehran 1976 incident. Tracked the UAP's radar cross-section and documented weapon system lock failures when trying to lock onto the object.
Civilian Witness, Ely, Cambridgeshire
Wrote to the Daily Express in 1978 describing an August 1956 sighting from Ely of a fast-moving white light and, separately, a Venom night-fighter and a group of odd amber lights. Later research tentatively connects his account to an earlier, aborted Venom sortie flown by Leslie Arthur and Grahame Scofield rather than to the main Lakenheath interception.
Farm Laborer — First Witness of the Night
Saucedo and passenger Joe Salaz were the first to report the Levelland phenomenon, around 10:50 PM on November 2, 1957, describing a blue flash and a low-flying, torpedo-shaped object that killed his truck's engine and headlights. The Air Force's investigator dismissed his reliability on the basis of his limited formal education — a characterization later researchers have criticized as untethered from any actual inconsistency in his account.
Farm Laborer — Passenger, First Encounter
Riding with Pedro Saucedo during the opening encounter of the Levelland case, Salaz corroborated Saucedo's account of the blue flash, the low-flying luminous object, and the truck's sudden electrical failure — the first independent corroboration of a pattern that would repeat across Hockley County for the next four hours.
Motorist — Second Levelland Encounter
Shortly after midnight on November 3, 1957, encountered a brilliantly lit, egg-shaped object roughly 200 feet long on the road east of Levelland near Whitharral; his vehicle's engine and lights failed on approach and recovered once the object climbed away. He was one of only three witnesses the Air Force's investigator interviewed directly.
Motorist — North Levelland Encounter
Driving roughly eleven miles north of Levelland around midnight on November 3, 1957, reported the same failure-and-recovery pattern as other witnesses: his engine died as a luminous object neared his vehicle and restarted once it moved away. He was not among the witnesses the Air Force chose to interview.
Texas Tech College Engineering Freshman
Widely regarded as the most technically credible Levelland witness: around 12:05 AM on November 3, 1957, his car's ammeter needle swung toward "discharge," his headlights dimmed, and his engine died as a bluish-green, egg-shaped object approached. Interviewed by the Air Force in 1957 and again in 1999 by researcher Antonio Rullán, his account remained consistent across four decades.
Farmer — Central Levelland Encounter
Around 12:15–12:25 AM on November 3, 1957, reported a pulsating, glowing object accompanied by the failure of his vehicle's headlights and engine, both of which returned to normal once the object departed — matching the pattern already reported by six prior Levelland witnesses that night.
Truck Driver — Whiteface Encounter
Near the community of Whiteface at roughly 12:45 AM on November 3, 1957, watched a round, glowing object shift color from orange to blue-green as it descended toward the roadway; his truck's engine and headlights failed in the same pattern reported throughout the night.
Motorist — Smyer Encounter
At approximately 1:15 AM on November 3, 1957, in the Smyer area southeast of Levelland, reported an elliptical object at close range on the roadway that produced an identical vehicle failure before ascending vertically and departing.
Levelland Volunteer Fire Chief
Driving north of Levelland between roughly 1:00 and 1:45 AM on November 3, 1957, saw a streak of light accompanied by dimming headlights and a nearly stalled engine — a public official with no discernible motive to fabricate, adding another occupationally credible witness to the night's record.
Hockley County Sheriff
Personally fielded the flood of Levelland phone calls and drove out with Deputy Pat McCulloch to investigate. At approximately 1:30 AM on Oklahoma Flat Road, the two saw a brilliant, oval, red light cross the highway roughly 300–400 yards ahead — a sitting sheriff reporting a sighting while on duty, in front of his own deputy, a category of testimony the Air Force's brief field investigation never seriously addressed.
Hockley County Sheriff's Deputy
Riding with Sheriff Weir Clem on Oklahoma Flat Road when the two men observed a brilliant red light crossing the highway ahead of their patrol car around 1:30 AM on November 3, 1957, corroborating his superior's account in real time.
Levelland Police Department, Night Dispatcher
Worked the police desk through the entire night of November 2–3, 1957, personally taking all approximately fifteen incoming calls and creating the dispatch log that remains the single most important contemporaneous record of the Levelland case. In 1999, more than four decades later, he was one of two surviving witnesses interviewed directly by researcher Antonio Rullán.
KP
Active since 1975
Forestry Crew Witness
U.S. Forest Service officer who was part of the logging crew with Travis Walton in November 1975. He witnessed the large glowing disc in the Apache-Sitgreaves National Forest and took the polygraph tests administered by Arizona authorities, passing them successfully.
JT
Active since 2004
USN Petty Officer & Sighting Witness
U.S. Navy Petty Officer Third Class aboard the USS Princeton during the 2004 Nimitz encounters. He watched the high-resolution FLIR video feed of the "Tic Tac" craft in the ship's signal center and testified to its instantaneous acceleration and lack of thermal signature.
KM
1912 – 1989
Primary Eyewitness, Flatwoods Monster Sighting
A local resident and mother of two boys who, on September 12, 1952, led a group of children and a West Virginia National Guardsman up a hill in Flatwoods to investigate a bright red fireball landing. In the woods, she witnessed a 10-foot-tall mechanical/organic creature with a spade-shaped cowl and glowing red eyes, which hissed and glided towards them. She suffered from severe throat swelling and nausea for several days due to a sickening metallic mist. She remained steadfast in her account throughout her life.
EL
1935 – 2005
Guardsman & Eyewitness, Flatwoods Monster Sighting
A 17-year-old member of the West Virginia National Guard who joined Kathleen May and the young boys on the night of September 12, 1952. Lemon carried the flashlight that illuminated the 10-foot-tall green-bodied entity on the hill, causing it to glide and hiss. He fainted in terror during the encounter. He later suffered from severe throat irritation and nausea. His dog, which ran ahead and barked at the entity, became violently ill and died shortly after the incident.
FV
1958 – 1978
Pilot & Eyewitness, Valentich Disappearance
Australian pilot who mysteriously disappeared over Bass Strait in 1978 after reporting a large metallic, green-lit object orbiting his Cessna 182L. His final words to air traffic control were: "It is hovering and it is not an aircraft."
GV
1921 – 2008
Civilian Advocate & Father of Frederick Valentich
Father of pilot Frederick Valentich who campaigned extensively for public release of the Melbourne Flight Service radio recordings and dismissed government explanations of pilot disorientation or suicide.
CH
1931 – 2011
Eyewitness & Abductee, Pascagoula Abduction
Shipyard worker who, along with Calvin Parker, reported being levitated and examined by three robot-like, claw-armed entities near the Pascagoula River in October 1973. Maintained his testimony under polygraph testing.
CP
1954 – 2023
Eyewitness & Abductee, Pascagoula Abduction
The younger witness of the 1973 Pascagoula abduction who suffered psychological trauma following the event. Wrote a detailed book in 2018 revealing previously undisclosed details of the spacecraft's interior.
AG
Science Teacher & Eyewitness, Westall Sighting
Science teacher at Westall High School who witnessed the disc landing and was subsequently threatened by government authorities to keep quiet. His testimony is widely considered a key pillar of the Westall case's credibility.
JT
b. ~1951
Student & Eyewitness, Westall Sighting
One of the primary Westall High School students who ran to the landing site paddock, witnessed the physical impressions left in the grass, and was reportedly detained and questioned by unidentified officials.
TB
Student & Eyewitness, Westall Sighting
Student at Westall High School who observed the three silver discs maneuvering over the school playing fields and landing in the nearby Grange paddock, describing their movement as completely silent.
VC
Local Resident & Witness, Westall Sighting
A local resident who rushed to the Grange paddock immediately after the landing, observing and photographing the swirled grass rings before military personnel secured the area.
KR
Chef & Eyewitness, Calvine Sighting
One of the two hotel chefs who photographed the large diamond-shaped craft hovering silently near Calvine, Scotland in August 1990 before it shot vertically upwards.
Calvine Calvine UFO Incident
DS
1936 – 2008
Bow-hunter & Eyewitness, Cisco Grove
A bow-hunter who spent a night in a tree in September 1964, defending himself with arrows and matches against three humanoid entities and a gas-emitting robot.
SD
1918 – 2003
Pseudonym of Adriaan Beers; industrialist and writer
Dutch mechanical engineer and car importer who reported a USO encounter in 1967 in the Oosterschelde, receiving extensive briefings on the advanced civilization of Planet Iarga.
AR
Eyewitness & Abductee, Hormigueros Case
Puerto Rican witness who took detailed color photographs of a disc-shaped craft being pursued by a military F-14 fighter jet, following a reported abduction in May 1988.
LP
1957 – 2012
Eyewitness & Abductee, Prospect Kentucky
Art student and truck driver who experienced missing time in January 1977 and later described under hypnosis being examined by three giant colored blocky machine-like entities.
JS
1901 – 1972
Chicken Farmer & Eyewitness, Eagle River
A WWI veteran and chicken farmer who reported receiving three salt-free buckwheat pancakes from the occupants of a metallic disc craft in exchange for well water.
Eagle River Eagle River Pancake Incident
Radio Announcer, KEYL — Long Prairie, Minnesota
Nineteen-year-old KEYL radio announcer whose car engine, headlights, and radio died before an upright, rocket-shaped object on Highway 27 on October 23, 1965. Reported three six-inch, eyeless "beer-can" shaped entities standing beneath the object before it departed with a humming sound. Vouched for by Todd County Sheriff James Bain as sober and honest.
Todd County Sheriff, Minnesota
Responded to Jerry Townsend's October 23, 1965 report and, with Officer Lavern Lubitz, discovered three parallel strips of an oily residue on Highway 27, the case's only physical trace evidence. Personally vouched for Townsend's sobriety and honesty to APRO's Coral Lorenzen by phone.
Long Prairie Police Department, Minnesota
Accompanied Sheriff James Bain to the Highway 27 site on the night of October 23, 1965, and jointly discovered the three parallel oily roadway strips that constitute the Long Prairie case's only physical trace evidence.
Peripheral Witness (age 14), Todd County, Minnesota
Reportedly observed an unusual, "inverted sombrero"-shaped lighted object through a telescope roughly fifteen minutes before Jerry Townsend's Highway 27 encounter began the same evening. Never formally interviewed by Blue Book, APRO, or NICAP investigators.
Capital Airlines Pilot, Washington National Airport
Awaiting takeoff clearance in his DC-4 on the night of July 19, 1952, Pierman observed six white, tailless, fast-moving lights over a 14-minute period while in direct radio contact with controller Harry Barnes. Each visual sighting he called out matched a radar "pip" that vanished from the scope the instant he reported an object streaking away at high speed.
Control Tower Operator, Godman Army Airfield
First Godman Field witness to the January 7, 1948 sighting, taking the initial Kentucky Highway Patrol report and personally relaying the tower's request to Capt. Mantell's flight. His 1948 written statement is a foundational primary source; a far more elaborate 1996 television interview decades later introduced new, disputed details absent from the original account.
PO
Tower Officer, Godman Army Airfield
Described the January 7, 1948 object through binoculars as resembling "a parachute" with sunlight reflecting off its surface and red coloring near the bottom — a description closely matching the appearance a Skyhook balloon and its instrument payload would present from a distance.
SO
Control Tower, Godman Army Airfield
Alongside T/Sgt. Blackwell, one of the first two Godman personnel to visually confirm the January 7, 1948 object, describing it as resembling "an ice cream cone topped with red" — a description that gave the case one of its most enduring popular nicknames.
One of the officers summoned to the Godman tower to confirm the January 7, 1948 sighting, describing the object as "a teardrop, round" — broadly consistent with, though not identical to, his colleagues' independent descriptions of the same object.
CC
Confirmed the object's visibility to fellow tower personnel and investigators on January 7, 1948, adding another independent, on-duty military witness to the Godman Field sighting roster.
GH
Active 1948
Commanding Officer, Godman Army Airfield
Summoned to the control tower as senior officer present on January 7, 1948, Hix personally confirmed the object through binoculars, describing it as "very white" and "like an umbrella with a red top," and estimating its apparent size at roughly one-quarter that of the full moon. As base commander, his corroboration lent institutional weight to the report.
CH
Photographed five exposures of a V-formation of lights from his parents' Lubbock backyard on the night of August 30–31, 1951, using his father's Kodak 35 camera. Sold the images to the Lubbock Avalanche-Journal for $10; they ran nationwide and in Life magazine, becoming some of the most reproduced UFO photographs of the era. Never wavered from his account across nearly five decades of interviews, telling researcher Kevin Randle in the 1990s he still had no idea what he had photographed.
JB
fl. 1951
Resident, Lubbock, Texas
Watched several groups of lights pass over his home on the night of August 25, 1951, the same evening as the Texas Tech professors' first sighting. When a third group circled his house, Bryant and his wife identified the objects, by sight and sound, as plovers — one of the earliest and most direct pieces of evidence cited for the case's leading conventional explanation.
Chief Pilot, Eastern Air Lines Flight 576
A Tennessee-born WWII Army Air Forces veteran who rose to lieutenant colonel, commanded an Air Transport Command base on Ascension Island, and had logged over 8,500 flight hours by 1948. First to spot the object on the night of July 24, 1948, Chiles banked his DC-3 to avoid a possible collision and gave Project Sign a detailed statement and sketch two days later, never materially altering his account for the rest of his life.
Co-Pilot, Eastern Air Lines Flight 576
A North Carolina native with wartime experience flying B-29 Superfortresses, Whitted independently confirmed Capt. Chiles' sighting from the right seat on July 24, 1948. His own witness statement and sketch agreed with Chiles' on the object's general size and wingless silhouette but described the illuminated "windows" differently — a divergence still cited in modern re-analyses of the case.
Passenger, Eastern Air Lines Flight 576; Assistant Editor, American Education Press
A Columbus, Ohio educational publisher, McKelvie was the only one of twenty passengers aboard awake at 2:45 AM on July 24, 1948. He saw a brief, undifferentiated "eerie streak of cherry-red fire" rather than any structured object — a materially thinner account than either pilot's, frequently cited by proponents of the meteor explanation.
NM
Active 1950
General Manager, Great Falls Electrics Baseball Club
While inspecting Legion Park ahead of a game on August 15, 1950, Mariana spotted two bright, silvery, rotating discs crossing the sky and ran to his car for his Revere 16mm movie camera, capturing roughly sixteen seconds of Kodachrome color film — one of the earliest motion-picture UFO records on record. He showed the footage to civic groups for weeks before it reached the Air Force, later insisted the returned reel was missing dozens of its clearest frames, and sued columnist Bob Considine for slander after a 1951 Cosmopolitan article mocked his account. Mariana later hosted the regional sports radio program "Nick's Picks" for 26 years.
VR
Active 1950
Secretary, Great Falls Electrics Baseball Club
Nineteen years old in August 1950, Raunig was walking Legion Park with her employer Nick Mariana when she independently spotted the same two silvery discs, corroborating his account of the sighting's initial moments before he ran for his camera.
WM
Active 1948
Air Force Crew Chief, Robins Air Force Base, Georgia
On duty roughly 150 miles from the main encounter, Massey observed a cylindrical, wingless object trailing fire about an hour before Chiles and Whitted's sighting and was personally certain it was not a meteor — an independent, geographically separated data point Project Sign treated as partial corroboration of the same night's reports.
NM
1947 – 2003
Primary Witness, Exeter UFO Incident
Eighteen years old and three weeks from reporting for U.S. Navy service, Muscarello was hitchhiking home to Exeter, New Hampshire on September 3, 1965 when a huge, silent, red-lit object rose from behind a farmhouse and drifted toward him, forcing him to dive into a roadside ditch. His report at the Exeter Police Station led directly to the corroborating sighting by patrolmen Eugene Bertrand and David Hunt. He served three tours in Vietnam aboard the USS Boston, returned to Exeter, and never altered his account before his death in 2003.
Patrolman, Exeter Police Department; Korean War-era Air Force veteran
Less than two hours before driving Norman Muscarello back to the Kensington Road field, Bertrand independently encountered a separate motorist reporting an identical glowing object. He became the first professional witness to the object itself, radioing the station in alarm, and later co-authored two detailed written rebuttals to Project Blue Book's proposed "Big Blast" explanation. He died in 1998 without ever altering his account.
DH
d. 2011
Patrolman, Exeter Police Department
Dispatched by radio to Eugene Bertrand's location with no advance briefing, Hunt arrived within minutes and independently observed the same silent, wingless, red-lit object. His account matched Bertrand's closely in size, behavior, and lighting pattern; he co-authored the officers' written objections to the Air Force's proposed explanation and died in 2011, the last of the three original witnesses.
WG
Primary Witness; Anglican Missionary, Boianai Mission Station
A 31-year-old ordained Anglican priest with a decade of missionary and educational service in the Territory of Papua, Gill kept a contemporaneous handwritten log during the June 26–27, 1959 sightings at Boianai and was the first to wave at the humanoid figures reported on the object's upper deck. J. Allen Hynek, who met him in 1973, called him "a painstaking, methodical, and unexcitable person, just the sort to stand calmly by and take notes." He never materially altered his account before his death in 2007.
AR
20th century
Corroborating Witness; Teacher, Boianai Mission Station
A trained teacher on the Boianai mission staff who stood beside Rev. William Gill throughout the June 27, 1959 sighting. He was the second person to wave at the figures on the object's deck, waving both arms overhead, and reported that two of the four figures reciprocated — independent corroboration of the case's most distinctive detail.
SM
20th century
Corroborating Witness; Mission Assistant, Boianai Mission Station
A mission assistant on the Boianai staff who observed the object alongside Rev. William Gill and Ananias Rarata across both principal nights of the June 1959 sighting, and one of the twenty-five signatories to the mission's formal written statement documenting the encounter.
GP
Primary Witness; Banana Farmer, Euramo, Queensland
A 28-year-old banana farmer driving a tractor near Horseshoe Lagoon on Tully, Queensland when he observed a grey, saucer-shaped object rise from the swamp and depart at high speed on January 19, 1966. Discovered the resulting clockwise-swirled mat of flattened reeds — the first of the "Tully saucer nests." Maintained his account, including his rejection of the official whirlwind explanation, consistently across more than fifteen years of interviews, including a detailed 1981 re-interview by researcher Bill Chalker.
Amateur Pilot & Trucking Company Owner, Stephenville, Texas
A self-described skeptic who watched an enormous, silent, brightly lit object for roughly twenty minutes through binoculars from a hillside campfire outside Stephenville on January 8, 2008, alongside two fellow private pilots. Estimated the object at half a mile to a mile across, calling it "bigger than a Wal-Mart," and said two F-16s appeared to chase it without closing the distance. Became the case's most frequently quoted witness and later disputed the military's mapped-airspace explanation.
Erath County Constable, Dublin, Texas
A sworn law-enforcement officer who, on the evening of January 8, 2008, watched a red glowing orb resolve into nine or ten flashing lights pursued by apparent jets from outside his Dublin, Texas home. Filed an official account, gave more than 100 media interviews, and appeared twice on CNN's Larry King Live, telling King: "I don't know what I saw… I don't know if it was part of an experiment, military or what." Witnessed a renewed round of unexplained lights alongside Sergeant Jim Clifton in fall 2008.
Rancher, Machinist & Welder, near Dublin, Texas
Reported a separate, earlier close-range daytime sighting in late December 2007, viewing through a rifle scope what he described as a large, flat, seamless metallic object hovering roughly 300 feet over his family's pasture — more than a week before the main January 8, 2008 flap. Came forward publicly only after the wider story broke, and later described what he characterized as low-altitude military overflight harassment of his property.
Witness; Former U.S. Air Force Navigation Specialist
A former U.S. Air Force navigation specialist who witnessed the January 8, 2008 Stephenville lights and was notably careful in his public description: "I didn't call them flying saucers or extraterrestrials. All I said was that it was unidentified flying objects."
Witness, Stephenville, Texas
A Stephenville local who witnessed the January 8, 2008 lights, describing them plainly: "I've never seen anything that fast — maybe a rock or a missile or something."
Sergeant, Erath County Sheriff's Office
A sheriff's sergeant who, alongside Constable Lee Roy Gaitan, independently witnessed a renewed round of unexplained lights over Erath County in the fall of 2008, remarking: "In my 35 years of law enforcement, I have never seen anything like it."
Retired District Nurse, Llandderfel
Living at the foot of the Berwyn Mountains on the night of the January 23, 1974 earthquake, Evans described a round, brilliantly illuminated reddish-orange glow on the mountainside that shifted color before fading. Reinterviewed by Margaret Fry in 1991, seventeen years later, her account remained detailed and consistent; she has never claimed to know what she saw.
Local Resident, Berwyn Mountains area
Reported a separate sighting of an object hovering near Cadair Berwyn on February 13, 1974, roughly three weeks after the earthquake-night events, describing it as departing "like lightning." His account is evidentially distinct from, and less corroborated than, the January 23 earthquake-night reports.
Farmhouse Resident, Berwyn Mountains area
Independently described a bright, clearly defined orange circle descending toward the mountainside on the night of the January 23, 1974 earthquake, corroborating the general character of Pat Evans's account while differing on some specific details.
First Officer, Pan American World Airways
A Naval Air Transport Service patrol-bomber veteran of World War II with intensive aircraft-recognition training, Nash was flying the DC-4 on the night of July 14, 1952 when he and William H. Fortenberry watched eight glowing discs maneuver over Chesapeake Bay. Nash led the pilots' post-event speed calculations, gave a detailed formal statement to Air Force investigators, co-authored the account for True magazine, and personally rebutted Donald Menzel's optical explanations in a published exchange. He later flew Pan Am's Berlin corridor routes for some fifteen years before retiring in 1977, never altering his account.
Second Officer, Pan American World Airways
A veteran of the U.S. Navy's air experimental wing, Fortenberry was flying his first run on the New York–Miami route on July 14, 1952 when he independently confirmed William B. Nash's sighting of eight maneuvering discs from the right seat, giving his own consistent statement to Air Force investigators. Five years later, on November 8, 1957, he was lost as Second Officer aboard Pan Am Flight 7, which disappeared over the Pacific Ocean; his body was never recovered. His son Ken Fortenberry later wrote a book investigating the crash.
Flight Captain, Pan American World Airways
Held overall command of the DC-4 on the night of the July 14, 1952 sighting but was in the passenger cabin, off the flight deck, when the objects appeared, and did not personally witness them. The original Air Force intelligence cable identified the flight by his name as aircraft commander of record even though Nash and Fortenberry were the actual eyewitnesses.
PH
1909 – 1990
Aerodynamicist, NASA Langley Research Center (formerly NACA)
A Berkeley-trained mechanical engineer who worked for NACA and its successor NASA from 1939 to 1970, Hill independently witnessed maneuvering amber-colored objects near Langley Field on July 16, 1952, two days after and a few miles from Nash and Fortenberry's encounter. The sighting redirected much of his subsequent career toward quietly analyzing UFO reports for their aerodynamic and propulsion implications, culminating in his posthumously published 1995 book Unconventional Flying Objects: A Scientific Analysis, which argued UFOs "obey, not defy, the laws of physics."
Pilot, American Airlines Flight 139
A veteran American Airlines captain with roughly two decades and several million miles of commercial flying experience, Killian spotted three color-shifting lights off his DC-6B's left wingtip near Williamsport, Pennsylvania on February 24, 1959, and watched them pace his aircraft for approximately 45 minutes while keeping continuous, unsuccessful watch on his own onboard radar. He publicly and specifically rejected the Air Force's KC-97/B-47 refueling explanation before American Airlines instructed him to stop discussing the case.
First Officer, American Airlines Flight 139
Occupied the right seat alongside Capt. Peter W. Killian on the night of February 24, 1959, and independently confirmed his captain's account of the three lights' position, coloration, and formation-holding behavior over the roughly 45-minute sighting.
Pilot, United Airlines Flight 937
Independently tracked three objects for roughly 30 minutes between Lock Haven, Pennsylvania and Youngstown, Ohio on February 24, 1959, on a route overlapping Capt. Peter W. Killian's American Airlines flight, landing at Akron and filing a corroborating report with Flight Engineer L. E. Baney.
Flight Engineer, United Airlines Flight 937
Served alongside Capt. A. D. Yates aboard United Airlines Flight 937 on February 24, 1959, independently corroborating the crew's roughly 30-minute tracking of three objects between Lock Haven, Pennsylvania and Youngstown, Ohio.
Captain, Safe Air Ltd
Commanding a Safe Air Armstrong Whitworth Argosy freighter on the night of December 21, 1978, Powell and first officer Ian Pirie maintained visual and intermittent radar contact with a bright, house-sized object for an extended stretch of their Blenheim–Christchurch run over the Kaikōura coast, while Wellington air traffic control simultaneously logged unidentified returns on ground radar.
First Officer, Safe Air Ltd
Flying alongside Vern Powell on December 21, 1978, Pirie's own account of the encounter — "so close it was almost frightening…the size of a house, burning in the sky" — remains one of the case's most vivid single pieces of witness testimony, given years later to documentarian Paul Davidson.
Captain, Safe Air Ltd
Piloting the Argosy that carried an Australian television crew on December 30–31, 1978, Startup first alerted reporter Quentin Fogarty's team to "a huge, bright white light with a red tinge to it" pacing the aircraft over the Kaikōura coast, and later co-authored the 1980 book The Kaikōura UFOs with Neil Illingworth.
First Officer, Safe Air Ltd
Bill Startup's co-pilot on the December 30–31, 1978 television-crew flight over Kaikōura, Guard gave a notably measured retrospective account decades later, stating plainly he did not believe in UFOs while acknowledging the professional strain the sighting's aftermath caused him.
Officer, Royal New Zealand Air Force, Woodbourne
The case's earliest documented witness, Uffindall observed a light from the Woodbourne tarmac around 11:30 PM on December 21, 1978 that reversed course, multiplied into three lights, and appeared to execute deliberate manoeuvres — a sighting that preceded, and helped trigger the alert chain leading to, Vern Powell and Ian Pirie's own encounter later that night.
Pilot, Executive Xingu Aircraft (PT-MBZ)
Flying Colonel Ozires Silva on the night of May 19, 1986, Pereira aborted his landing approach at São José dos Campos at least three times over roughly 25 minutes to continue observing luminous objects the crew could not identify, later stating he had "never seen anything like it" in his flying career and judging the object's agility "impossible" for any piloted craft he knew of.
Captain, TAE Flight JK-297 (Sud Aviation Super Caravelle)
An experienced commercial airline captain reported to have logged more than 8,000 flight hours, Lerdo de Tejada was piloting TAE flight JK-297 from Palma de Mallorca to Las Palmas on November 11, 1979 when intense red lights approached the aircraft on an apparent collision course near Ibiza. Unable to obtain identification from Barcelona or Torrejón de Ardoz radar, he diverted to Manises Airport for an emergency landing — the first commercial airliner emergency landing in aviation history attributed to a UFO encounter. He rejected the later Escombreras conventional explanation for the rest of his life.
Co-Pilot, TAE Flight JK-297
Independently corroborated Capt. Lerdo de Tejada's account of unidentified lights closing on flight JK-297 on an apparent collision course during the November 11, 1979 encounter that forced the emergency diversion to Manises Airport. His consistent, independent testimony is one of the case's clearest instances of corroboration between two credentialed professionals on active flight duty, and has been weighed against later suggestions that the captain alone misjudged an ambiguous stimulus under personal stress.
TT
fl. 1969
Trainee Combat Pilot, Finnish Air Force
Flying a Fouga Magister jet trainer on a bombing-practice sortie at Pori Airport on April 12, 1969, Tukeva was directed by a flight controller to investigate seven pale-yellow, ball- or disc-shaped objects hovering nearby. Closing to visual range, he could not judge their exact size or distance for lack of reference points, then watched them accelerate away faster than his own 700 km/h jet could follow — the central account of the Seven Balloons of Pori, the only UFO sighting the Finnish Air Force has ever officially acknowledged. He later recounted the encounter publicly, including in a 1992 internationally distributed documentary.
JK
Trainee Pilot, Finnish Air Force (later Base Commander, Lappeenranta)
A second trainee pilot preparing for an unrelated navigation flight at Pori Airport on April 12, 1969, Kuronen overheard the flight controller's radio traffic and independently observed the same seven objects from the ground before Tarmo Tukeva's jet closed the distance, corroborating the sighting from a second vantage point. He went on to a career culminating in command of Lappeenranta Air Base and repeatedly confirmed the Seven Balloons of Pori sighting on the record across four decades, most notably in a 2009 Yle interview, while maintaining that he cannot explain what he saw.
CC
Officer, California Highway Patrol
On patrol with Officer Stanley Scott on Hoag Road east of Corning on the night of August 13, 1960, Carson watched an object abort a near-ground dive, climb to a stable hover, and twice sweep the patrol car area with a large red beam. He later corresponded in detail with NICAP investigator Walter N. Webb, providing a signed report and diagrams, and rejected every conventional explanation offered to him, stating he would "hate to try to take one of my cases into court with such weak arguments."
JM
Lieutenant Colonel, Deputy of Operations (Fighter Branch), USAF Headquarters
Career Air Force command pilot assigned to the Fighter Branch of the Deputy of Operations at U.S. Air Force Headquarters, the Pentagon — a post that made him professionally responsible for staying current on the design and silhouette of fighter aircraft worldwide. Co-piloting a B-25 bomber from Hamilton Field to Colorado Springs on July 24, 1952, McGinn and John R. Barton watched three silver, delta-shaped objects bank sharply and close to within 400–800 yards of their aircraft over the Carson Sink. On landing, he joined Barton in personally telephoning Air Defense Command to rule out any known aircraft in the area — a self-initiated check that helped make Project Blue Book case #1584 one of the program's strongest "Unidentified" files.
JB
Lieutenant Colonel, AFOOP-OP-D, USAF Headquarters
Career Air Force command pilot holding an operations post (AFOOP-OP-D) at U.S. Air Force Headquarters, the Pentagon. Flying alongside John L. McGinn aboard a B-25 bomber over the Carson Sink, Nevada, on July 24, 1952, Barton independently corroborated McGinn's description of three delta-shaped, silver objects that closed to within 400–800 yards of the bomber and departed at an estimated three times the speed of an F-86 Sabre in roughly four seconds. His original witness statement is preserved among the surviving Project Blue Book case documents for the sighting, logged as case #1584.
SS
Officer, California Highway Patrol
Co-witness with Officer Charles A. Carson to the August 13, 1960 encounter near Corning, California. Scott aimed the patrol car's own red emergency spotlight at the hovering object during one of its close approaches, after which it moved away — the case's clearest single detail suggesting the object was responding to the officers' actions. He also described the object appearing to "jump" discontinuously over rising terrain rather than following a continuous flight path.
CF
fl. 1960
Deputy, Tehama County Sheriff's Office
The deputy who telephoned the U.S. Air Force radar station at Red Bluff on the night of August 13, 1960 and obtained the operator's verbal confirmation of an unidentified target on scope — the case's only instrumented corroboration, contradicted by the station's commanding officer the next day. Fry independently witnessed the object himself from the sheriff's substation that same night, and returned to the field with Deputy Max Montgomery on two further occasions, observing four objects near Los Molinos on August 14 and another sighting that evening alongside a Corning police officer.
MM
Deputy, Tehama County Sheriff's Office
Corroborating witness alongside Deputy Clarence Fry at the Tehama County Sheriff's substation on the night of the primary Red Bluff sighting, August 13, 1960, and Fry's companion for the follow-up observation of four objects from a hillside near Los Molinos the following night. A trained deputy with no connection to the California Highway Patrol chain of command, his account independently reinforces both the original sighting and the pattern of continued activity in the days that followed.
RB
b. 1957
Captain, Aurigny Air Services
A 50-year-old commercial pilot with more than eighteen years of flying experience, Bowyer was flying a scheduled Britten-Norman Trislander service from Southampton to Alderney on April 23, 2007, when he observed two huge, stationary, sharply defined yellow-gold objects hovering at roughly 2,000 feet. He filed a same-day occurrence report with the UK Civil Aviation Authority, supplied supplementary drawings that October, and was independently corroborated within minutes by a second airline captain, Patrick Patterson, flying an unrelated route. Bowyer went on to present his account at the November 2007 National Press Club UFO panel in Washington, D.C., and remained a public voice on the case for over a decade, including a 2021 interview for The New Yorker.
PP
Captain, Blue Islands
Commercial pilot flying a scheduled Blue Islands BAe Jetstream service from the Isle of Man to Jersey on April 23, 2007, an unrelated route that happened to pass near the same stretch of Channel Islands airspace where Ray Bowyer was independently observing two large, stationary objects. Patterson reported a bright object roughly 1,950 feet below his own aircraft with no prior knowledge of Bowyer's sighting, learning of it only when Jersey air traffic control relayed the connection between the two reports. He subsequently submitted his own separate written statement to the Civil Aviation Authority, providing the case's second, wholly independent professional-pilot report.
PK
fl. 2007
Zone Controller, Jersey Air Traffic Control
The on-duty controller Ray Bowyer contacted during the April 23, 2007 sighting near Alderney. Kelly checked his radar in real time and reported no solid contact, at most a very faint, ambiguous primary return he judged likely of meteorological origin — an assessment later scrutinized, and found largely inconclusive, by researcher David Clarke's 2013 transcript analysis. Kelly was also the intermediary who informed Bowyer that a second pilot, Patrick Patterson, had independently reported a similar sighting minutes earlier.
EW
b. 1947
Building Contractor & Photographer
A Gulf Breeze, Florida home-building contractor who reported the first of what became roughly three dozen UFO photographs on November 11, 1987, describing repeated encounters with a top-shaped craft and a paralyzing "blue beam" through May 1988. Walters passed two 1988 polygraph exams administered by a non-UFO-affiliated examiner and co-authored two best-selling books with his wife, Frances Walters. In June 1990 a foam-and-paper model closely matching the photographed object was discovered in the attic of his former home; investigators found the model's backing bore handwriting Walters himself acknowledged resembled his own, on blueprint paper tied to a house he had built before the sightings began. Walters had also served 18 months in the late 1960s for forgery and auto theft before receiving a 1990 gubernatorial pardon. He has never recanted his account, maintaining the model was planted to discredit him.
FW
Active 1987 – 1992
Secondary Witness & Co-Author
Wife of Ed Walters who corroborated several of his reported encounters, including a December 2, 1987 incident in which she said she pulled her husband free of a blue beam, and a February 7, 1988 episode in which he photographed her own attempt to escape it. She co-authored The Gulf Breeze Sightings (1990) and UFO Abductions in Gulf Breeze (1994) with her husband. The couple divorced in November 1992, dividing an estimated $2.5 million in book and media proceeds.
TS
fl. 1990 – 1993
Confessing Acquaintance
A young Gulf Breeze acquaintance of Ed Walters whose attorney father came forward days after the June 1990 model discovery, saying his son had told him more than two years earlier of Walters's plan to profit from a UFO hoax. Smith went on camera in February 1993 describing his own firsthand observation of Walters staging double-exposure UFO photographs. His account was never tested in court, and Walters disputed it, but it became a central piece of the skeptical case alongside the recovered model.
Lieutenant, Pilot, 415th Night Fighter Squadron
Pilot of the Beaufighter crew whose late-November 1944 encounter over the Rhine Valley became the founding incident of the "foo fighters" case. Schlueter turned to intercept a row of orange lights reported by his intelligence officer, closing to a distance at which the objects maneuvered and vanished, with no radar contact ever established despite the aircraft's fully operational intercept set.
Lieutenant, Radar Observer, 415th Night Fighter Squadron
A Chicago native credited by most surviving 415th Night Fighter Squadron members with coining the "foo fighters" name after the Smokey Stover comic strip's catchphrase "where there's foo, there's fire." Meiers gave some of the case's most detailed and widely quoted pilot testimony, describing balls of fire that matched his aircraft's 260 mph airspeed and calling their behavior harmless but persistent, "like will-o'-the-wisps."
Lieutenant (later Captain), Intelligence Officer, 415th Night Fighter Squadron
Riding along on the founding November 1944 mission specifically to observe operational conditions, Ringwald was the first to spot the row of lights that opened the "foo fighters" case. As squadron intelligence officer he subsequently compiled and forwarded a consolidated report of fourteen separate incidents that prompted XII Tactical Air Command's candid admission that the phenomenon could not be explained.
Lieutenant, Pilot, 415th Night Fighter Squadron
A "foo fighter" witness whose testimony is notable for explicitly ruling out the era's most obvious conventional suspicion — a German jet aircraft — based on close-range observation: "we were very close to them and none of us saw any structure on the fire balls."
Lieutenant, Pilot, 415th Night Fighter Squadron
Reported one of the "foo fighters" case's more distinctive encounters: a wingless, cigar-shaped object glowing red that held position just yards off his wingtip for several minutes before disappearing — a morphology notably different from the more common spherical "ball of fire" reports.
Headmaster, Broad Haven Primary School (1977)
The headmaster of Broad Haven Primary School at the time of the February 4, 1977 Broad Haven school sighting, Llewellyn did not personally witness the object but conducted the case's central piece of documentary evidence: separating the children the following Monday, taking individual written and drawn accounts, and recording his own contemporaneous, carefully hedged assessment in the school diary later examined directly by academic historian David Clarke. His recorded judgment — that he did not believe the children capable of a sustained, sophisticated hoax while explicitly keeping an open mind toward a natural explanation — is considerably more cautious than the language later popular retellings of the case have sometimes attributed to him.
Child Witness, Broad Haven Primary School (age 9–10 in 1977)
One of the most consistently quoted and most publicly identified of the fifteen child witnesses to the Broad Haven school sighting, Davies has described watching a silver, "cigar-shaped" object with "a dome covering the middle third" from behind the playground fence. He has spoken about the sighting across five decades, including a BBC Radio Wales interview marking the 40th anniversary in 2017 and a dedicated 2018 episode of the Astonishing Legends podcast, describing being bullied at school over his account and stating that no proposed explanation has matched what he personally witnessed. Davies has been explicit that he never personally claimed the object was of extraterrestrial origin, describing it instead as "an unexplained and strange aircraft."
Self-Confessed Prankster (1996 Confession)
A local Pembrokeshire businessman who, in a 1996 newspaper interview nearly twenty years after the 1977 events, admitted to having worn a silver-lined protective suit and walked around the Broad Haven area during 1977 purely "for a bit of fun." His confession offers a specific, named, first-person source for at least part of the "silver man" element reported across the wider Broad Haven school sighting's associated 1977 Pembrokeshire wave, matching the RAF's own contemporary "oil-refinery fire suit" theory, though it does not by itself account for the object the school's child witnesses described.
Primary Witness, Ripperston Farm (1977)
The wife of dairyman Billy Coombs and, by her own and her family's account, the central witness to a months-long series of encounters at Ripperston Farm beginning in early 1977 — a hovering, football-sized light that pursued her car, a seven-foot silver-suited figure at the farmhouse window, and, in her most extraordinary claim, a close encounter she believed took place aboard a craft. A responding Dyfed-Powys police officer later confirmed the couple's fear that night was "absolutely genuine," whatever its ultimate cause.
Dairy Farmer, Ripperston Farm (1977)
The dairyman who worked Ripperston Farm with his wife Pauline Coombs and their children throughout 1977, Billy corroborated the silver-suited figure seen at their sitting-room window and was the family member most directly involved in discovering the case's most extraordinary claim: cattle repeatedly found relocated between securely fastened fields and yards, with no sign the family's own restraints had been disturbed and their dog failing to raise any alarm.
Hotel Owner, Haven Fort Hotel, Little Haven (1977)
The owner of the Haven Fort Hotel near Broad Haven, Granville reported large, long-limbed figures in "plasticated" or boiler suits near her property in April 1977, part of the wider Pembrokeshire wave surrounding the Ripperston Farm reports. A visiting RAF Brawdy squadron leader suggested she had likely seen oil-refinery workers in protective suits — an explanation she rejected at the time even as officers privately requested discretion "to avoid public alarm."
Schoolteacher & Chief Supervisor (Surveillant Général), Collège d'Oloron-Sainte-Marie (1952)
The primary named witness to the October 17, 1952 Oloron-Sainte-Marie angel hair sighting. Watching with his wife and two sons from his garden, Prigent used binoculars to study what he described as a huge white cylinder tilted at roughly 45 degrees, trailing a plume, with some thirty red spheres each ringed in yellow — "like miniature versions of Saturn" — moving in zigzag patterns before the group watched a white, hair-like fiber drift down over the town.
First Witness, Gaillac Sighting (1952)
A 64-year-old resident of the Route de Toulouse in Gaillac, France, Mme Doré was the first to notice the October 27, 1952 sighting, drawn outside by her chickens' unusual agitation before she and her son watched luminous discs and a whitish flying cylinder cross the sky — the event that repeated the Oloron-Sainte-Marie "angel hair" phenomenon ten days after it was first reported, and gave the case its second named location.
Corroborating Witnesses, Gaillac Sighting (1952)
A married couple, along with the husband's 63-year-old father, who lived near Mme Doré on the Route de Toulouse in Gaillac and independently corroborated her account of the October 27, 1952 sighting to the contemporary press, describing the same luminous, rotating discs and whitish cylinder emitting smoke that Mme Doré reported.
RAF Officer, RAF Brawdy (1977)
An RAF Brawdy squadron leader who personally visited hotelier Rose Granville after her own 1977 sighting near Broad Haven and suggested she had likely seen oil-refinery workers in protective suits — an explanation Granville rejected at the time — while privately asking that the visit be kept discreet "to avoid public alarm," part of the same wider Ministry of Defence pattern of quiet, non-alarmist engagement documented across the 1977 Pembrokeshire wave.
GM
Pastor, Sts. Peter and Paul Church, Norwood, Ohio
Pastor of the Norwood parish since 1938, Miller purchased the Army-surplus searchlight for the August 1949 Jitney Carnival that led directly to the first sighting of the Norwood Searchlight Incident. He became the case's central custodian, retaining searchlight operator Donald Berger's logs and his own photographs and film for years afterward, appearing on WCPO-TV to discuss the case, and personally turning his surviving material over to investigator Leonard Stringfield in 1954. His brother, Fr. Cletus Miller, dean of the Institutum Divi Thomae, independently corroborated the pivotal October 23, 1949 sighting.
Searchlight Operator; University of Cincinnati Army ROTC
Recruited by Rev. Gregory Miller to operate a carnival searchlight, Berger's beam was the first to catch and hold the object at the center of the Norwood Searchlight Incident on August 19, 1949, and he continued operating the light during several of the nine sightings that followed. His own detailed logs — including the case's single most anomalous, uncorroborated claim, that the object continued glowing after the beam moved off it — became the documentary backbone that Leonard Stringfield worked from after 1954.
JL
Captain, Esquadra 20, Ota Air Base (1957); later General, Chief of Staff of the Portuguese Air Force (1977–1984) and of the Armed Forces (1984–1989)
As a 27-year-old squadron commander, Lemos Ferreira led three sergeant pilots on a September 4, 1957 night navigation exercise out of Ota Air Base during which all four tracked a color-changing luminous sphere for roughly 35 minutes — the encounter documented in The Ota Air Base Encounter. He restated the account largely unchanged across public interviews spanning more than five decades, including as a retired four-star general. His subsequent career — General in 1976, Chief of Staff of the Air Force from 1977 to 1984, and Chief of Staff of the Armed Forces from 1984 to 1989 — gave the case unusual institutional weight: while still serving as Air Force Chief of Staff, he personally authorized the civilian CNIFO research commission's access to Air Force data and to Ota itself, a decision secondary sources tie directly to his own 1957 experience.
AC
Sergeant Pilot, Esquadra 20, Ota Air Base
One of three sergeant pilots flying as wingmen to Captain José Lemos Ferreira on the September 4, 1957 night navigation exercise documented in The Ota Air Base Encounter. No source consulted for that case file preserves further biographical detail beyond his participation in the flight and his signature on the same-night declaration.
Sergeant Pilot, Esquadra 20, Ota Air Base
A second of the three sergeant pilots flying as wingmen to Captain José Lemos Ferreira on the September 4, 1957 encounter documented in The Ota Air Base Encounter. As with his fellow sergeants, no source consulted preserves further biographical detail beyond his role in the flight and the declaration.
Sergeant Pilot, Esquadra 20, Ota Air Base
The third sergeant pilot flying as a wingman to Captain José Lemos Ferreira on the September 4, 1957 encounter documented in The Ota Air Base Encounter. Together with Covas and Oliveira, Marcelino provides the case's core corroboration: three additional trained military pilots, independently alerted rather than told in advance what to expect, who reached the same conclusion as Ferreira on landing.
ČT
Captain; Aircraft Commander/Pilot, Mi-24D Hind, 51st Helicopter Regiment, Czechoslovak People's Army
Commanded the Mi-24D gunship crew scrambled against an unidentified cigar-shaped object over the crowded Vranov Reservoir on July 12, 1987, the encounter documented in The Vranov nad Dyjí Helicopter Incident. Withheld ordered weapons fire over the civilian swimmers below, then executed a hard evasive bank near the Mi-24's service ceiling when the object turned directly toward the helicopter. Gave a further on-camera account in 1999 on the Czech Television program Fakta ČT-1.
IP
Crew Member, Mi-24D Hind, 51st Helicopter Regiment, Czechoslovak People's Army
The second named crew member aboard Captain Čestmír Tesařík's helicopter during the July 12, 1987 encounter documented in The Vranov nad Dyjí Helicopter Incident, credited alongside Tesařík with reconstructing the object's calculated speed from the encounter's closing and separation rates. His exact rank is given inconsistently across secondary sources.
fl. 1987
Crew Member, Mi-24D Hind, 51st Helicopter Regiment, Czechoslovak People's Army
The third named crew member aboard the Mi-24D during the July 12, 1987 encounter documented in The Vranov nad Dyjí Helicopter Incident. No source consulted for that case file provides independently published testimony from Šero in his own words; his corroboration reaches the modern record through Tesařík's and Špaček's accounts of the crew's shared experience.
EN
fl. 1987–2018
Former Czechoslovak Border Guard
Came forward publicly in 2018 with a secondhand account of unusual aerial activity observed from his own post along the Austrian border around the same period as the July 12, 1987 Vranov nad Dyjí Helicopter Incident. Treated in that case file as suggestive, independently sourced ground corroboration rather than confirmed, itemized evidence.
RD
Student, Massulas, Sardinia, Italy
The first witness to notice the phenomenon at the Taizé Landing Case on August 12, 1972, around 2:00 a.m., when she saw a "star" descending unusually from the sky and alerted her companions. One of four young people who subsequently crossed the field to approach the object at close range, placing her among the small group whose testimony anchors the case's most specific details.
FT
Second-Year Psychology Student, Mâcon, France
One of four witnesses who approached the object at close range during the Taizé Landing Case. Alongside an unnamed student from Dijon, Tantot reported a tingling sensation in his hands and knees during the close approach, and is among those who described the object up close as resembling a large, dark haystack.
DT
fl. 1996
Assistant Director of Self-Government, Selkirk First Nation; Pelly Crossing, Yukon
The only named eyewitness among the 31 documented observers of the December 11, 1996 Fox Lake / Yukon mass sighting; every other witness in investigator Martin Jasek's report chose anonymity. While out on his trapline northeast of Pelly Crossing, Trudeau watched a huge, silent row of lights come over a hill roughly 300 metres away; he reported that when his flashlight beam happened to fall on the object it accelerated toward him before coming to rest around 275–300 metres out, close enough that he "had to turn my head from one side to the other to take it all in."
TP
Neighbourhood Watch Coordinator, Pontcanna, Cardiff
A 64-year-old neighbourhood watch coordinator from Pontcanna, Cardiff, who told the South Wales Echo in the days after the St Athan police helicopter sighting made national headlines that he had "seen strange things in the sky over the years" and suggested the object trailing the helicopter was "something not from this planet," dismissing an official balloon or weather explanation. His remarks illustrate the wider public reaction the story provoked rather than a first-hand sighting of the object itself.
GW
Retired RAF Glider Pilot; St Mellons, Cardiff
A retired RAF glider pilot from St Mellons, Cardiff, who reported his own daylight sighting on June 8, 2008 — some hours after the St Athan police helicopter crew's pre-dawn encounter and roughly ten miles away — describing an object that caught his eye "in the corner of my eye" while he was watching a passing aircraft overhead. His aviation background made his account one of the more closely noted follow-on reports amid the same brief wave of South Wales press coverage, though no investigator has established any direct connection between the two sightings beyond their shared date and region.
AC
fl. 1958 (age 24)
Primary Witness, Loch Raven Dam UFO Incident
One of two young men driving near Loch Raven Dam, Towson, Maryland, on the night of October 26, 1958, when their car's engine, headlights, and ignition died simultaneously as a large, glowing egg-shaped object hovered roughly 100–150 feet above a nearby bridge. Cohen and companion Phillip Small reported reddened skin on the side of their bodies facing the object after it departed and were examined at St. Joseph's Hospital in Baltimore; Cohen later told investigators plainly that when the object appeared and their car died, "there was no place to run."
PS
fl. 1958 (age 27)
Primary Witness, Loch Raven Dam UFO Incident
The second of the two witnesses at Loch Raven Dam on October 26, 1958, riding with Alvin Cohen when their car's electrical system failed as the object hovered ahead. Small later gave one of the case's most quoted lines to investigators and the press: "I am sorry I saw it; I wish I hadn't seen it" — a remark repeatedly cited in retrospectives as capturing the genuine unease of an ordinary witness confronted with something he could not explain.
JW
fl. 1992
Local Businessman; Originating Witness of the 1992 Bonnybridge Wave
A Bonnybridge-area businessman whose January 1992 sighting while driving on the Falkirk Road toward Droves Loan is generally credited as the report that opened the modern Bonnybridge wave. Accounts of his description vary in secondary sources — some describe a "shiny star-shaped object hovering above the road" that blocked his path before departing at high speed, others a "large triangular-shaped craft low down in the sky, which had small lights on its underside" — a discrepancy this site's own case file treats as a feature of how a 30-plus-year-old origin story has been retold, rather than resolving it in favor of either version. Walker's report, once publicized locally, prompted councillor Billy Buchanan to begin formally logging further sightings from other residents later that same year.
Highway Maintenance Engineer, Orange County Road Department
A 38-year-old highway maintenance engineer for the Orange County Road Department, Heflin was photographing an obscured railroad-crossing sign near Myford Road, Santa Ana, on August 3, 1965 when he saw a hat-shaped metallic object cross the road ahead of his work van and captured it on four Polaroid frames. He loaned the first three original photographs to two men claiming to represent NORAD in September 1965; they were never returned, and NORAD itself denied any knowledge of the incident. Heflin cooperated fully with NICAP, the U.S. Marine Corps, and the U.S. Air Force throughout a multi-year investigation that found him a consistently reliable witness, and in 1993 the three lost originals mysteriously reappeared in his mailbox, enabling a definitive 2000 scientific reanalysis. He died in October 2005 after a long illness.
GF
Factory Worker; Photographer of the September 9, 1965 "Thing" Photograph
A 23-year-old factory worker, Faulkner was travelling to his mother's home in Warminster on September 9, 1965 when he saw an object flying low and fast over the south of the town. Unable to properly frame the fast-moving object in his viewfinder, he fired the shutter regardless; the resulting grainy photograph, which he sent to journalist Arthur Shuttlewood with instructions to "do as he seemed fit with it," was published in the Warminster Journal and the Daily Mirror the following day and remains the single most reproduced image associated with the case.
MB
fl. 1964
Warminster Housewife; First Reported Witness (December 1964)
A Warminster housewife, Bye was walking toward church in the early hours of Christmas Day 1964 when she was startled by an unearthly crackling, whining sound she later described as being "like branches being pulled over gravel." Her report to journalist Arthur Shuttlewood is generally credited as the originating account of what became known as the "Warminster Thing" — a sustained wave of unexplained sounds and, from mid-1965 onward, aerial sightings that drew national press attention to the town for more than a decade.
RJ
fl. 1965
Motorist; Corroborating Witness, Anaheim, California (August 1965)
Driving with his wife on the Santa Ana Freeway in Anaheim, roughly ten miles from Rex Heflin's own sighting site, during the same week as Heflin's August 3, 1965 encounter, Joseph reported a large, self-luminous, disc-shaped object with a rounded dome sitting atop high-voltage transmission lines above the freeway, close enough (roughly 40 feet) that the couple could confirm it made no sound. Numerous other motorists stopped to observe the object, yet no contemporary media coverage of the sighting was ever broadcast or published, a gap later investigators cited as evidence of inconsistent public UFO-reporting practices rather than proof the sighting did not occur; NICAP investigators and physicist James E. McDonald independently interviewed the couple and found them reliable.
JT
1920–2011
Fireman & Amateur Photographer; Photographer of the Solway Firth Spaceman Image (1964)
A serving fireman with the Carlisle City Fire Brigade and a committed amateur photographer and local historian, Templeton photographed his five-year-old daughter Elizabeth on Burgh Marsh on May 23, 1964. The middle of his three frames appeared to show a bulky, faceless figure in white behind her, which he insisted he had not seen through the viewfinder. Kodak and the Carlisle City Police forensic laboratory both examined the negative and found no evidence of tampering. He maintained his account unwaveringly for nearly five decades, dismissed his own later "men in black" story as "a leg-pull" within months of it first circulating, and refused a Ministry of Defence request to hand over his original camera and film. Researchers David Clarke and Andy Roberts later proposed the figure was his own wife, overexposed and unnoticed — an identification his family rejected to the end.
Wife of Jim Templeton; Proposed Identification of the "Solway Firth Spaceman" Figure
Present with the rest of the family on Burgh Marsh on May 23, 1964. Researchers David Clarke and Andy Roberts identified her as the likely source of the "spaceman" figure in her husband Jim Templeton's famous photograph, proposing she had walked into the shot from outside the camera's limited viewfinder coverage and been rendered white and featureless by strong backlighting. The Templeton family disputed the identification specifically on the grounds that she was wearing a light or pale blue dress that day, not white, a factual dispute this site's own research found no surviving independent photograph to resolve either way.
Police Constable, West Yorkshire Police; Primary Witness, Todmorden Police Encounter (1980)
An on-duty constable searching for stray cattle on Burnley Road at the edge of Todmorden in the early hours of November 28, 1980, Godfrey reported a rotating, domed, disc-shaped object hovering low over the road, radio failure, and roughly 15–30 minutes of missing time, later corroborated by a dry, swirled patch on the otherwise rain-soaked road and split soles on his police-issue boots. Five months earlier he had been one of the officers who discovered the body of Zigmund Adamski at a nearby coal yard. Hypnotic regression sessions in 1981 produced a detailed abduction narrative involving a bearded figure named "Yosef" and small robot-like beings, material Godfrey himself has consistently declined to endorse as definitely real, even while maintaining the original sighting was genuine. West Yorkshire Police required him to undergo a psychiatric fitness-for-duty evaluation, which found him mentally sound; he left the force in 1984.
ZA
d. June 1980
Polish-Born Coal Miner; Subject of an Unexplained 1980 Todmorden Death
A 56-year-old miner from Tingley, West Yorkshire, Adamski disappeared while out shopping on June 6, 1980 and was found dead five days later atop a coal heap in a Todmorden coal yard, his clothing unusually clean, his hair freshly cut, his watch and wallet missing, and unusual burns on his skin treated with an unidentified ointment. Alan Godfrey, later the central witness of the Todmorden Police Encounter, was one of the attending officers. The coroner recorded an open verdict, finding a heart attack the medical cause of death while stating the circumstances of where Adamski had been could not be answered. No investigator has established a shared-cause link between Adamski's death and Godfrey's UFO sighting five months later, beyond Godfrey's own documented presence at both.
JG
Police Chief, Fyffe, Alabama Police Department (1989)
On the night of February 11, 1989, Garmany and assistant chief Fred Works pursued reports of an unusual object outside Fyffe city limits and personally observed a large, silent, triangular object hovering low over County Road 43. He described it for the rest of his life in consistent terms: "What I saw the first time was like nothing I ever saw before. It was not a helicopter, it was not a plane. Not a sound." He had no documented prior involvement with UFO research or reporting before the case.
FW
Active 1989
Assistant Police Chief, Fyffe, Alabama Police Department (1989)
Alongside Chief Junior Garmany, Works pursued and observed the large, silent, triangular object along County Road 43 on February 11, 1989, and radioed the neighboring Geraldine police chief, who independently reported an object of his own that night. Works remained available to journalists for decades, giving the case's most detailed retrospective account in a 2021 interview; his later size and speed estimates grew considerably more specific and dramatic than his own more modest 1989 statements, an instructive example of memory elaboration over time.
TO
Active 1989–1993
Fyffe-Area Police Officer & Amateur Filmmaker; Associated with a Disputed 1989 Polaroid Photograph
Identified in press retrospectives as a Fyffe-area police officer, Oliphant is associated with the "UFO Polaroid" that circulated during and after the February 1989 wave and was separately reported to be investigating regional cattle mutilations around the same period. He appeared as himself, credited as a police officer from Fyffe, on the syndicated series Sightings in a 1993 episode covering UFO hot spots, cattle mutilation, and hoaxing. No independent photo-analytic examination of his Polaroid has been located by this site's research.
NL
Active 1967
Owner of the Mare “Lady” (Later Known as “Snippy”)
Lewis and her husband Berle Lewis owned the three-year-old Appaloosa mare found mutilated on the Harry King family ranch in Colorado's San Luis Valley on September 9, 1967. Lewis told reporters she was certain a flying saucer had killed her horse and reported that touching the hide near the body had burned her hand, statements that helped drive the case's national wire-service coverage under headlines like "Flying Saucers Killed My Horse!" No source documents any prior involvement by Lewis in UFO research or promotion before this case.
BL
Active 1967
Co-Owner of the Mare “Lady” (Later Known as “Snippy”)
An Iowa native who lived with his wife Nellie Lewis in a cabin on the Harry King family ranch, Berle Lewis co-owned the mutilated mare and reported an unusual "sickening sweet," medicine-like odor at the discovery site. He appears more thinly in the surviving record than his wife, whose public statements drove most of the case's press coverage.
HK
Active 1967
Rancher; Discovered the Horse's Body with His Mother, Agnes King
Ran the family cattle ranch roughly seventeen miles northeast of Alamosa, Colorado, on which Nellie and Berle Lewis lived and kept their horses. King personally found the mutilated mare's body on September 9, 1967, alongside his mother Agnes King, and returned to the site the following day with the Lewises to examine it further.
AK
b. c. 1880; age 87 in 1967
Rancher's Mother; Present at the Discovery, Reported a Separate Sighting
Present alongside her son Harry King when he found the mutilated mare's body on the family ranch on September 9, 1967, Agnes King separately reported having seen a large, undetailed object near the ranch — the case's only direct sighting claim of any kind. No further description, date, or corroboration of her sighting survives in any source located by this site's research.
WL
Active 1967
Alamosa Veterinarian; Discovered Bullet Wounds While Mounting the Skeleton
Took custody of the mare's remains in December 1967 to clean and mount the skeleton as a curiosity. While preparing the bones, Leary discovered two infected, small-caliber bullet wounds in the animal's hindquarters — the single most consequential physical finding in the case, made through direct professional examination rather than secondhand description.
BP
Active 1967
Alamosa County Sheriff
Publicly attributed the mare's death to a lightning strike without, per this site's research, having examined the site himself, then later acknowledged the absence of expected lightning-strike burn patterns without proposing a replacement explanation. His handling of the case is treated by this site as a documented investigative shortfall, independent of how the case was ultimately resolved by other parties.
FF
b. c. 1960
Claimed Abductee, Cergy-Pontoise Affair, France (1979)
A 19-year-old who reportedly vanished from a parked car near Cergy-Pontoise, France, on November 26, 1979, reappearing eight days later in a cabbage field with no claimed memory of the interval. Per organizer Jean-Pierre Prévost's later confession, Fontaine spent the missing period hidden in an acquaintance's apartment as part of a staged publicity hoax; Fontaine himself later remarked that if he had to do it again he "would tell any story," while continuing for years to publicly maintain the original abduction account.
JP
Organizer & Confessed Architect, Cergy-Pontoise Affair, France (1979)
A 25-year-old salesman who reported the initial 1979 sighting and disappearance alongside Salomon N'Diaye, then positioned himself as the aliens' true intended contact, claiming ongoing telepathic messages from an entity he called Haurrio and publishing Le Grand Contact. In June 1983, Prévost publicly confessed on French radio that "the Cergy-Pontoise affair is bogus from start to finish," admitting he personally organized the hoax and hid Franck Fontaine in a Pontoise apartment for the full eight days to promote his own channeled-contact publishing venture, which subsequently failed financially.
SN
b. c. 1954
Co-Witness, Cergy-Pontoise Affair, France (1979)
A 25-year-old co-witness who, alongside Jean-Pierre Prévost, reported the November 1979 sighting and Franck Fontaine's disappearance to French gendarmes. N'Diaye continued to publicly maintain the original abduction account even after Prévost's 1983 confession that the entire affair had been staged; this site's research found no evidence he played an organizing role in the hoax comparable to Prévost's own.
MC
U.S. Air Force Control Tower Operator, 1921st AACS Squadron, Det. 3, Carswell AFB
On the night of February 4, 1954, this Carswell Air Force Base control tower operator tracked an unidentified, engineless, gray fuselage-shaped object continuously through standard binoculars for the sighting's full six-minute duration, from its approach until it disappeared to the northeast — the single most sustained direct visual observation documented in that case's surviving Project Blue Book record. No source consulted preserves his first name or further biographical detail beyond his rank, surname, and duty position.
EC
U.S. Army Signal Corps Student Radar Operator, Fort Monmouth, NJ
A student operator at the Army Signal Corps radar school at Fort Monmouth, New Jersey, who on the morning of September 10, 1951, while demonstrating automatic radar tracking to a group of visiting officers, picked up a fast-moving low-altitude target his AN/MPG-1 set could not lock onto — a contact he judged, from the set's manual readings, to be moving at roughly 700 mph, faster than any conventional jet of the era. The visiting officers behind him independently witnessed the anomalous scope behavior in real time. No plotting record was kept, consistent with the set's use as a training instrument rather than an operational tracking radar.
U.S. Air Force T-33 Jet Trainer Pilot
Piloting a T-33 jet trainer at 20,000 feet near Point Pleasant, New Jersey, roughly twenty-five minutes after PFC Eugene A. Clark's radar contact at Fort Monmouth, Rogers spotted a dull silver, disc-like object far below, banked over, and dove after it. He reported the object descending toward Sandy Hook before it stopped, hovered, and sped off out to sea — a maneuver profile his rear-seat observer, Maj. Edward Ballard Jr., corroborated. Rogers and Ballard both rejected the balloon explanation ATIC's Henry Metscher later proposed, citing several points in his analysis they considered mistaken.
U.S. Air Force Officer, Rear-Seat Observer
Riding as observer in Lt. Wilbert S. Rogers's T-33 jet trainer over Point Pleasant, New Jersey on September 10, 1951, Ballard independently corroborated Rogers's sighting of a dull silver, disc-shaped object roughly 30 to 50 feet in diameter descending toward Sandy Hook before it hovered and departed out to sea. When Lt. Col. N.R. Rosengarten's investigating team later suggested the object was a released weather balloon, Ballard and Rogers both pushed back, arguing the analysis contained real errors.
JA
Pilot, Chicago & Southern Air Lines
A 31-year-old airline captain with roughly 7,000 flight hours and seven years' service with Chicago & Southern Air Lines, Adams was piloting a DC-3 from Memphis toward Little Rock on the night of March 20, 1950 when he and First Officer G.W. Anderson Jr. sighted a roughly 100-foot disc-shaped object with lighted lower portholes climb past their aircraft near Stuttgart, Arkansas. Adams estimated the object's speed at "not less than 1,000 mph" and, in a United Press wire interview, stated his belief it was a secret American aircraft rather than an extraterrestrial craft. He and Anderson appeared on Eleanor Roosevelt's NBC program "Today with Mrs. Roosevelt" within about a week of the sighting.
Co-Pilot, Chicago & Southern Air Lines
A 30-year-old first officer with roughly 6,000 flight hours, Anderson was flying alongside Capt. Jack Adams on the March 20, 1950 Memphis-to-Little Rock run when the two men sighted a disc-shaped, porthole-lit object near Stuttgart, Arkansas. Anderson independently corroborated Adams's account of the object's shape, lighting, and high-speed climbing maneuver, and joined him in both the United Press wire interview and the subsequent appearance on Eleanor Roosevelt's NBC program.
JH
Pilot in Command, British Overseas Airways Corporation
A 33-year-old former RAF wartime squadron leader with roughly 7,500 commercial flying hours and 256 prior Atlantic crossings, Howard was in command of the Boeing 377 Stratocruiser RMA Centaurus on the night of June 29, 1954 when he and his crew watched a huge, continuously shape-changing object and six smaller companions pace their aircraft for 18 minutes over Quebec and Labrador. He sketched the object for the press within a day of landing and personally rebutted Chapman Pincher's contemporaneous aircraft-reflection theory, arguing shadows could not be "thrown towards" a light source the way the theory required.
Co-Pilot, British Overseas Airways Corporation
A former wartime RAF squadron leader flying as first officer aboard RMA Centaurus, Boyd radioed Goose Bay approach control while the June 29, 1954 sighting was still in progress, creating a contemporaneous air-traffic record of the encounter rather than one reconstructed after landing. He independently corroborated Capt. James Howard's account, stating publicly that the crew had seen "something solid, something maneuverable, and something being controlled intelligently."
DW
Air Hostess, British Overseas Airways Corporation
A 28-year-old air hostess aboard RMA Centaurus, Webster watched the June 29, 1954 sighting from the passenger cabin alongside dozens of the flight's 51 passengers, giving this case a rare degree of simultaneous cabin-crew corroboration alongside the flight-deck account. She described the display to the press as "the most exciting sight I've ever seen, but a little creepy."
CG
U.S. Air Force C-47 Transport Pilot
On the night of December 5, 1948, this USAF transport pilot and his crew reported two independent green fireball sightings within roughly twenty-two minutes of each other — near Las Vegas, New Mexico and again over the Sandia Mountains — the first same-night, multiple-sighting military report of the wave that triggered the Air Force's formal investigation. Secondary published sources render his surname with minor spelling variation ("Goede"/"Goade").
AZ
Captain, Alitalia Flight AZ284 (Milan–Heathrow)
A Grosseto, Tuscany-born Alitalia airline captain who, on the evening of April 21, 1991, was flying an Alitalia McDonnell Douglas MD-82 descending through 22,000 feet near Lydd, Kent on the inbound airway to London Heathrow when a khaki-brown, unlit object roughly three meters long passed an estimated 1,000 feet above his aircraft on a reciprocal heading. He immediately alerted his co-pilot — "Look out, look out" — who also saw the object, and radioed London Air Traffic Control, which confirmed an unknown primary radar return ten nautical miles behind the airliner. His same-night report triggered a Civil Aviation Authority and Ministry of Defence investigation that ruled out a missile, weather balloon, and space debris without ever identifying the object.
JD
Captain, Air France Flight AF 3532 (Nice–London)
An Air France airline captain who, on January 28, 1994, was flying an Airbus A320 (registration F-GFKG) at roughly 11,700–11,900 meters near Coulommiers, Seine-et-Marne, when a flight attendant in the cockpit pointed out an object he initially took for an aircraft banked 45°, then recognized as a huge, dark reddish-brown, lens-shaped mass with fuzzy edges that his first officer, Valérie Chauffour, separately described changing shape from a disc to a chevron. Duboc reported the object to Reims air traffic control per regulation but, fearing professional ridicule, did not file a written report until three years later, after which he was interviewed by SEPRA and by the COMETA committee under General Denis Letty. He has continued discussing the case publicly in French media and maintains that the near-simultaneous, but geographically disputed, military radar track supports a genuine, unexplained encounter over a mundane one.
VC
First Officer, Air France Flight AF 3532 (Nice–London)
First officer alongside Captain Jean-Charles Duboc aboard Air France Flight AF 3532 on January 28, 1994. Chauffour separately observed the object described by the flight's cockpit crew near Coulommiers, describing it as remaining stationary relative to the aircraft while exhibiting a "variable geometry," changing from a disc shape into a chevron — a description that diverges in specific detail from Duboc's own "evolving lens" account, a discrepancy this catalogue's own case file treats as a genuine, disclosed feature of the record rather than glossing over it. Her account was independently recorded by SEPRA investigator Dominique Weinstein alongside Duboc's own statement.
VL
Civilian Airline Pilot, Pioneer Airlines Flight 63
Minutes after a USAF crew's report on December 5, 1948, this Pioneer Airlines DC-3 captain radioed Kirtland Air Force Base directly to describe a large fireball approaching his aircraft nearly head-on, changing color from orange-red to green and appearing "as big, or bigger, than a full moon" — a civilian, commercially licensed pilot's account that closely corroborated the military sighting reported the same night.
MM
1924 – 2004
Lavender & Wheat Farmer, Valensole, France
A locally respected 41-year-old farmer who, on July 1, 1965, reported a close-range encounter with a landed egg-shaped craft and two small humanoid beings in his lavender field near Valensole. Temporarily paralyzed by one of the beings, Masse maintained a materially consistent account for the rest of his life while declining to elaborate on the full content of the encounter — testimony Jacques Vallée called "the best-authenticated close encounter incident in continental Europe."
MD
1921 – 1996
Metalworker, ANF Blanc-Misseron; resident of Quarouble, France
A 34-year-old metalworker living in a former railway crossing-keeper's cottage near Quarouble, Dewilde reported the September 10, 1954 encounter with a landed craft and two humanoid figures that left him temporarily paralyzed, and a second, markedly different encounter with his young son one month later. His case opened the autumn 1954 French UFO wave that Aimé Michel would go on to study, though Dewilde's own testimony continued to accumulate significant new detail across four decades, becoming a widely cited example of narrative embellishment in a long-running contactee account.
Duty Controller, RAF Boulmer
The duty controller on the night shift at RAF Boulmer when a civilian telephone call reported two bright objects over the North Sea on July 30, 1977. Wood watched the objects for roughly 100 minutes alongside two NCOs, then personally checked the station's radar picture once they disappeared from sight — initiating the cross-station radar corroboration that became the case's most distinctive evidence. The Ministry of Defence's own file rated Wood and his colleagues "reliable and sober."
PS
Pseudonym; real identity never disclosed
Sole Witness, Ilkley Moor Incident (1987)
Pseudonym used to protect the identity of a retired police officer who, on December 1, 1987, photographed a small humanoid figure while crossing Ilkley Moor, West Yorkshire, and later reported a reversed compass and roughly two hours of missing time. Under hypnotic regression conducted by Dr. Jim Singleton in March 1988, he described a full abduction narrative. He refused all payment for his story and signed copyright of the photograph over to investigator Peter Hough. His insistence on permanent anonymity means his stated occupation and background have never been independently verified, and folklore historian David Clarke has identified this as the central reason the case cannot be meaningfully re-investigated today.
NCO, RAF Boulmer
One of two non-commissioned officers who watched the July 30, 1977 sighting over the North Sea alongside Flight Lieutenant A.M. Wood for the full observation period, giving an account the Ministry of Defence's file found consistent with Wood's own report.
NCO, RAF Boulmer
The second non-commissioned officer present for the July 30, 1977 sighting, watching alongside Flight Lieutenant A.M. Wood and Corporal Torrington and corroborating the description of the objects parting and one changing shape as it moved west.
Commanding Officer, RAF West Freugh
Filed the classified report on the April 4, 1957 radar incident and, under explicit Air Ministry sign-off, issued the case's most substantive public statement, affirming the object was "of some substance — quite definitely not a freak" and vouching for the qualifications of the Ministry of Supply civilians who tracked it. In 1971, still apparently bound by the case's original sensitivity, sought and received MoD permission before discussing it with researcher Julian Hennessey.
Air Traffic Control, RAF West Freugh
The RAF officer on duty in West Freugh's air traffic control room on April 4, 1957, when the Balscalloch radar unit radioed in to report unidentified contacts; confirmed the same unexplained returns on West Freugh's own radar picture, giving the case its second independent station of corroboration.
Civilian Radar Operator, Ministry of Supply, Ardwell Unit
One of two Ministry of Supply specialists operating the Ardwell trials radar, 14 miles south of the initial April 4, 1957 contact. When asked by the Balscalloch unit to check his own scope, independently confirmed a target considerably larger than a normal aircraft return at the same stated range and bearing.
Civilian Radar Operator, Ministry of Supply, Ardwell Unit
Alongside Charles Hollands, jointly confirmed the Ardwell radar's independent reading of the unidentified target on April 4, 1957, giving the case its third documented station of cross-checked corroboration.
PK
Ground Observer Corps Volunteer, Black Hawk, South Dakota
A trained civil-defense spotter for the Cold War-era Ground Observer Corps who, on the evening of August 5, 1953, watched a stationary red light execute a series of abrupt directional changes and reported it in real time by telephone directly to Ellsworth AFB's radar duty controller. Her report, independently confirmed within minutes by ground radar, set in motion the two F-84 intercepts that followed.
KL
Active 1946
Farmer/haymaker, Lake Kölmjärv, Sweden
Along with fellow haymaker Beda Persson, witnessed a roughly two-meter, ashen-gray, blunt-nosed projectile dive into Lake Kölmjärv at 11:45 a.m. on July 19, 1946, throwing up a tall column of water. His description — a rigid, torpedo-like object rather than a bird, balloon, or aircraft — became the basis for the Swedish military's most intensive single search of the entire ghost rocket wave.
BP
Active 1946 (age 18)
Maid/haymaker, Lake Kölmjärv, Sweden
An eighteen-year-old maid working alongside Knut Lindbäck on the southwestern shore of Lake Kölmjärv, Persson independently corroborated his account of the July 19, 1946 impact, describing a smashing sound she attributed to the water thrown up by the object rather than any explosion or light. A third witness, fourteen-year-old Frideborg Tagebo, watching from the lake's northern shore, was located and interviewed decades later in 1984.
KL
Active 1946 (age 11)
Child witness, Kattisträsket, near Överkalix, Sweden
An eleven-year-old boy fishing a stream at Kattisträsket, roughly 30 kilometers from Lake Kölmjärv, Larsson reported a violent water cascade — "like detonating a mine," in his own words — only minutes before and miles from the better-documented Kölmjärv impact on July 19, 1946, suggesting to Swedish investigators that more than one object came down in the Norrbotten region that same early afternoon.
IH
Active 1946 (age 22)
Witness, Lake Marmen, near Söderhamn, Sweden
A twenty-two-year-old witness at Lake Marmen near Söderhamn, several hundred kilometers south of Lake Kölmjärv, Hansson reported hearing a violent noise before watching an object skip or "bounce" repeatedly across the water surface, throwing up a cascade roughly 20 meters high — one of at least four separate lake-impact reports logged by Swedish authorities on the single day of July 19, 1946.
ER
Photographer, Guldsmedshyttan, Sweden
Photographed a fast-moving, luminous streak over Guldsmedshyttan on July 9, 1946, producing what became one of the wave's most widely reprinted newspaper images. The photograph — the only ghost rocket image most researchers regard as plausibly authentic rather than staged or misattributed — shows an ambiguous bright trail consistent with both a genuine aerial projectile and a bright daylight meteor.
GS
Active 1946
Photographer, Gothenburg, Sweden
Filmed a cigar-shaped object trailing what he described as flames on color Paillard-Bolex movie film on August 22, 1946. When Swedish military officers screened the footage, it proved overexposed to the point of showing only white — a camera-aperture error that destroyed what would otherwise have been the wave's only moving-picture record. The military retained Skog's film; it was never returned to him.
GC
1918–2003
Railway worker, later entrepreneur ("Pollenkungen"); sole witness, Ängelholm encounter
A 28-year-old Swedish State Railways employee and amateur beekeeper with no prior public profile when he claimed, in 1971 — 25 years after the fact — to have encountered a landed disc and its crew in Kronoskogen forest on May 18, 1946. He credited the beings with knowledge behind his pollen-extract company Cernelle (founded 1953) and its subsidiary Allergon (1963), becoming a millionaire known as "Pollenkungen" (the Pollen King) and bankrolling hockey club Rögle BK's rise to Sweden's top division. In 1972 he built a permanent concrete monument to the encounter at the site, now a Swedish National Heritage Board-registered landmark. His own chief investigator, Clas Svahn, documented recurring inconsistencies in the story and in the physical artifacts Carlsson said he recovered.
CB
Active 1967–2015
Cernelle laboratory technician; secondary witness, artifact record
A laboratory technician at Gösta Carlsson's company Cernelle with no independent UFO claim of his own. Bergquist personally sketched the crystal rod and metal mugs Carlsson displayed in 1967, creating the only independent, dated record of their appearance at that time. His sketches — showing an unmarked rod and, per his 2015 statement to Clas Svahn, mugs that had not yet been destroyed in the fire Carlsson later claimed occurred in 1952 — became central evidence in researchers' skepticism about how Carlsson's story changed over time.
FM
1918 – 1983
Farmer/Truck Driver, Dexter Township, Michigan
Alerted by barking dogs on the evening of March 20, 1966, Mannor and his teenage son Ronald observed a hovering, pyramid-shaped object with shifting red, white, and blue-green lights over a swamp on their farm — the report that opened the Michigan “Swamp Gas” UFO Wave. Having personally encountered real swamp gas during military service in Louisiana, Mannor explicitly rejected Dr. Hynek's explanation as inapplicable to what he saw. He endured years of public ridicule and unwanted attention afterward, telling CBS's Walter Cronkite he regretted ever reporting it, and died in Dexter in 1983.
GK
Class of 1969
A resident of McIntyre Residence Hall, Kohn wrote a first-person account of the March 21, 1966 sighting just three days after it occurred — an unusually early, low-contamination witness record. She described "a glow around it" with lights that "appeared to be pulsating," and recalled watching the object's colors shift as the multi-hour sighting progressed.
KS
Patrol Officer, Yorktown Police Department, New York
On patrol on Route 118 near the Triangle Shopping Center in Yorktown, New York on the night of March 24, 1983 — after the department's switchboard had already logged more than a hundred calls about lights in the sky — Officer Soravilla watched a huge, silent, delta/V-shaped array of red, green, and amber lights pass less than 1,000 feet overhead, bank sharply roughly 45 degrees, and accelerate away. He radioed nearby Stewart Air Force Base to ask whether one of its C-5 transports was in the area; officials told him none had been. "It made me apprehensive," he said afterward. "There's no logical explanation for what that was." His partner that night, Officer William Wolf, independently described what he saw as a tight formation of small planes rather than a single object — a split reaction from two officers who witnessed the same event side by side that the case's investigators and skeptics have never fully reconciled.
DS
fl. 1980s
Putnam County Government Employee; Early Named Witness
A Putnam County government employee whose March 17, 1983 sighting near Brewster, New York was among the first detailed, named reports collected by Philip Imbrogno's investigation team the week before the large March 24 flap. Sant described a very large, dark gray, metallic-looking structure carrying iridescent lights moving slowly and silently at low altitude — a description investigators cited as an early, independently arrived-at match to the hundreds of reports that followed it within days.
BP
fl. 1980s
Resident, Brewster, New York; Amateur Videographer
A Brewster, New York resident who, on the night of July 24, 1984, captured amateur home-video footage of the light formation moving over the village — among the only moving-image records of the Hudson Valley UFO Wave to survive. Segments of the footage were broadcast on local television and reviewed by an optical specialist at the Jet Propulsion Laboratory, who could not positively identify the light source from the tape but also could not rule out conventional aircraft lights recorded at night, when depth and distance cues are notoriously unreliable on consumer video.
DS
d. 1983
Deputy Sheriff, Portage County, Ohio; Korean War-era U.S. Air Force veteran
First officer to see the object rise from the trees along Route 224 on April 17, 1966, Spaur stayed with the pursuit for its full 85 miles into Pennsylvania and became the case's most public and most damaged figure. He refused to sign a Project Blue Book statement limiting the sighting's duration, endured job loss, divorce, and years of hardship, and died in 1983.
WN
Auxiliary Deputy, Portage County, Ohio Sheriff's Office
Dale Spaur's partner on patrol car P-13 during the April 17, 1966 chase, Neff was present for the object's initial approach and reportedly considered drawing his weapon as it hovered overhead. He withdrew from public discussion of the case afterward, eventually relocating to Florida.
WH
20th century
Patrolman, East Palestine, Ohio Police Department
Alerted by radio traffic during the April 17, 1966 Portage County chase, Huston independently spotted the pursued object approaching his position and joined the pursuit as it passed. He quit the police force afterward, relocated to Seattle, Washington, became a bus driver, and began going by his middle name, Harold.
GB
Chief of Police, Mantua, Ohio; Portage County Deputy
Alerted by the same dispatcher's radio call that sent Dale Spaur and Wilbur Neff to Route 224, Buchert independently observed and photographed a matching object from near his own home at almost the same moment on April 17, 1966. The Air Force took custody of his negative and reported it "severely fogged"; no verifiable version has surfaced publicly since. He remained Mantua's police chief until his death in 1986.
FK
b. c. 1940
Central Witness, Knowles Family Mundrabilla Encounter
A 48-year-old Perth resident driving her three adult sons to Melbourne along the Eyre Highway when the family reported a glowing object pursuing and briefly lifting their Ford Telstar on the Nullarbor Plain in the pre-dawn hours of January 20, 1988. Police who examined the family at Ceduna described them as "extremely distraught," and Mrs. Knowles gave visibly distressed contemporaneous statements about the car's roof feeling "soft, warm and spongy" to the touch. She and her sons accepted a reported paid exclusive television interview in the following days, a detail investigators later cited as complicating independent verification of the account.
SK
b. c. 1967
Witness, Knowles Family Mundrabilla Encounter
The 21-year-old son of Faye Knowles, most commonly described in secondary accounts as the family's driver on the night of the encounter, though the original UPI wire report instead names his mother as the one driving and swerving to avoid the object — one of several small but genuine discrepancies between the earliest wire coverage and later retellings. In a contemporaneous television interview he described accelerating to roughly 200 km/h while trying to escape the object, a speed exceeding the S-rating of the vehicle's stock tires and a detail skeptics point to as a plausible mechanical explanation for the tire failure the family also reported.
PK
b. c. 1964
Witness, Knowles Family Mundrabilla Encounter
The eldest son of Faye Knowles, 24 at the time of the encounter, seated in the front passenger seat. He was the first to wind down a window during the incident and described being covered in a fine, foul-smelling dust. In a filmed interview days later he told a reporter, "I thought I was going to die," a statement psychologist Robert Bartholomew later cited as evidence of a genuine acute fright reaction rather than a fabricated hoax.
WK
b. c. 1970
Witness, Knowles Family Mundrabilla Encounter
The youngest son of Faye Knowles, 18 at the time of the encounter. His own account largely corroborated his mother's and brothers', describing the experience simply as "pretty scary" in a contemporaneous interview — a notably understated description relative to the dramatic press coverage the case received.
GH
Truck Driver & Corroborating Witness
A truck driver travelling the same stretch of Eyre Highway who independently reported an unusual light in his rear-view mirror around the same time as the Knowles family's encounter, describing it as resembling "a big fried egg hung upside down." Minutes later, at the Mundrabilla Roadhouse, he was the first outside party to inspect the family's car, confirming black ash on its interior and exterior and four indentations in its roof — a genuinely independent, contemporaneous observation of the aftermath, though not of the alleged physical interaction itself.
YL
fl. 1977
Soviet Writer & Philosopher, Karelia
The single most detailed eyewitness of the Petrozavodsk Phenomenon, observing the object for roughly fifteen minutes through an amateur telescope at 80x magnification from his dacha near Namoyevo. Described a lens-shaped body with a dark amethyst ring and sixteen pulsating "nozzle" points emitting red rays, and separately reported unseasonal rose blooming and a second bloom in roughly ten herbaceous plant species in his own garden in the days that followed — the case's only named, first-person source for a claimed biological effect.
NM
TASS Correspondent, Petrozavodsk
Filed the first official press account of the Petrozavodsk Phenomenon, published September 23, 1977 in Pravda, Izvestiya, Selskaya Zhizn, Sotsialisticheskaya Industriya, and the local Leninskaya Pravda. His description of the object "spreading out... in the form of a jellyfish" and "showering the city with a multitude of very fine rays" became the standard language repeated in nearly every subsequent Soviet and Western account of the case.
AB
1916 – 2000
Professional Underwater Photographer; Freelance Newspaperman
The civilian photographer whose four Rolleiflex exposures aboard the NE Almirante Saldanha on January 16, 1958 became the most reproduced UFO photograph series in Brazilian history. Born in Bahia and based in Niterói, Barauna was already a working photojournalist with a documented history in the genre years before Trindade: on November 10, 1954, in Mundo Ilustrado, he publicly exposed the 1952 Barra da Tijuca "flying disc" photographs as a manufactured hoax, going so far as to demonstrate the exact double-exposure trick — a joined pair of streetcar tokens photographed against a dark background, then combined with a real landscape shot — expertise skeptics later cited as evidence he had both the motive and the technical skill to fabricate his own case. Barauna never publicly recanted the Trindade photographs during his lifetime; the reversal came only after his 2000 death, through two mutually contradictory secondhand accounts from his own family. He died in Niterói on July 29, 2000.
Retired Captain, Brazilian Air Force; Primary Witness
A retired Brazilian Air Force officer serving as a civilian guest aboard the Almirante Saldanha's 1958 International Geophysical Year voyage, Viegas was among the first to spot the object and the man credited with alerting photographer Almiro Barauna to it. His formal account — "a disc shining with a phosphorescent glow, which, even in daylight, appeared brighter than the moon... a flattened sphere encircled, at the equator, by a large ring or platform" — became the case's canonical description, republished in APRO and NICAP bulletins for decades. His military background gave the Trindade sighting an early credibility the Navy itself would later lean on in its own internal correspondence.
Lawyer, Bank Executive; Captain, Submarine Hunting Club
A Rio de Janeiro lawyer and bank executive who captained a civilian sport-diving club invited aboard the Almirante Saldanha for the 1958 IGY voyage, Vieira Filho was, alongside Captain Viegas, one of the two men credited with first spotting the object and summoning Almiro Barauna to photograph it. For decades his name anchored ufology's oft-repeated figure of 47 to 48 corroborating witnesses on deck. In a considerably less-cited 2003 interview, however, Vieira Filho himself undercut that number, stating plainly that he did not know where the 48-witness figure had come from and did not even possess a crew roster to support it — a disavowal from one of the case's own founding witnesses that rarely accompanies the figure he is credited with establishing.
Retired Petty Officer, Brazilian Navy; Crewman, NE Almirante Saldanha
A rank-and-file Brazilian Navy crewman who was on deck aboard the Almirante Saldanha at Trindade Island on January 16, 1958, Ferreira was located and interviewed decades later by skeptical researchers Kentaro Mori and Rodrigo Moura Visoni. Unlike the case's officer and civilian witnesses, Ferreira did not corroborate the sighting, telling his interviewers he did not know what made everybody say they saw something, and recalling that no one on deck could point to where the object supposedly was and that the incident barely came up in conversation among the crew afterward. His account is one of the only ones obtained from an ordinary sailor rather than an officer, scientist, or civilian guest, and it complicates the case's frequently cited consensus of 47 to 48 corroborating witnesses.
PB
1927–2003
Physicist and businessman; civilian UAP investigator
Founder of Thunder Scientific Corporation, an Albuquerque instrumentation manufacturer, Bennewitz began filming what he believed were unidentified aerial objects from his Four Hills rooftop overlooking the Manzano Weapons Storage Area beginning in 1979, alongside recordings of unusual radio signals he associated with the activity. On October 24, 1980, he approached Kirtland's 1608th Security Police Squadron commander Maj. Ernest Edwards and later AFOSI agent Richard Doty with his findings. His civilian investigation, running parallel to but distinct from the security police's own August 1980 sighting reports, became the target of a documented Air Force disinformation campaign that fed him increasingly elaborate fabricated documents about underground alien bases and secret treaties. The campaign contributed to a severe psychological breakdown; Bennewitz was hospitalized in 1988 and died in 2003. His story is documented in Greg Bishop's Project Beta (2005) and the 2013 documentary Mirage Men.
Case File #116 Disinformation Manzano Thunder Scientific
ML
b. ~1952
Maintenance Worker, Buff Ledge Camp (1968)
A sixteen-year-old maintenance employee at Buff Ledge Camp on the evening of August 7, 1968, Lapp was on the boat dock with fellow staffer Janet Cornell when both reported watching a disc-shaped object descend into Lake Champlain and direct a beam of light at them. Troubled by a decade of recurring nightmares, Lapp contacted the Center for UFO Studies on Halloween night, October 31, 1978, prompting investigator Walter Webb's five-year investigation, including regressive hypnosis sessions under Dr. Harold Edelstein that recovered his account of being taken aboard a larger craft.
JC
Water-Ski Instructor, Buff Ledge Camp (1968)
A nineteen-year-old water-ski instructor at Buff Ledge Camp, Cornell was on the dock alongside Michael Lapp on August 7, 1968, when both reported the encounter over Lake Champlain. Having lost contact with Lapp after that summer, she had no memory of an abduction beyond "seeing lights" when investigator Walter Webb located her a decade later; her detailed account of being examined aboard a craft emerged only under separate regressive hypnosis, independently yet closely matching Lapp's own recovered narrative.
Television Cameraman, Televisa
A Televisa television cameraman who, while covering the July 11, 1991 total solar eclipse in Mexico City, filmed a circular object — silvery on top, dark underneath — near the eclipsed sun. His footage aired the same evening on Televisa's flagship nightly newscast 24 Horas, anchored by Jacobo Zabludovsky, making Arreguín's tape the first of the eclipse's UFO videos to reach a mass audience. A week later, journalist Jaime Maussan re-aired the same footage on Imevisión's 60 Minutos, crediting it as the catalyst for the wider wave of viewer-submitted videos. Arreguín has since accused Maussan of appropriating his footage without proper credit or compensation, a dispute the two have carried into Mexico's Instituto Mexicano de la Propiedad Industrial and which remained unresolved more than three decades later.
Independent Videographer; University Student
A 19-year-old university student who, while setting up his video camera to record the July 11, 1991 eclipse from central Mexico City, filmed what he described as a white dot in the sky that later resolved into a larger, light-emitting object. His tape was one of more than a dozen submitted after Jaime Maussan's broadcast, and it is cataloged among the roughly seventeen independently filmed videos of the event.
Independent Videographer; Businessman
A businessman who filmed an object roughly 60 miles from Mexico City during the July 11, 1991 eclipse, reporting a faint shadow beneath the object that convinced him it was not simply a star. Analysts reviewing his tape later noted that a real star and the planet Mars both appear in their correct celestial positions elsewhere in the same frame, a detail skeptics cite as evidence the "object" itself was also a genuine celestial body rather than a solid craft.
Independent Videographer; Engineer
An engineer who, at a Mexico City military air show roughly two months after the eclipse, filmed a bright, round object approximately ten meters in diameter that appeared to undulate and move quickly before departing — one of a second cluster of sightings that followed the original eclipse-day wave and helped sustain public and media interest into 1992.
Independent Videographer
An amateur videographer who captured a disc-shaped object traveling in a straight, steady line against the prevailing wind before it vanished from view, in a follow-on sighting near Mexico City roughly a year after the original 1991 eclipse case. His footage is frequently cited alongside Vicente Sánchez's as evidence that the post-eclipse surge in Mexican UFO reporting outlasted the original event itself.
Aerial Photographer, Instituto Geográfico Nacional de Costa Rica
A career government mapping technician who operated the automatically-triggered survey camera aboard the September 4, 1971 Instituto Geográfico Nacional (IGN) flight over Lago Cote, Costa Rica, during a routine topographic and hydrological survey commissioned by the national electricity utility, ICE, ahead of a proposed hydroelectric project. Loaiza saw nothing unusual during the flight itself; the anomalous frame was discovered only when the film was developed at IGN's San José laboratory. He has said the crew was informally told not to discuss the photograph afterward, and is set to speak on camera at length for the first time in the 2026 documentary The Cote Photo. His decades-long, consistent account — from a career civil servant with no apparent motive to fabricate evidence in the middle of an unrelated engineering survey — anchors the case's chain-of-custody argument.
Lake Cote UFO Photograph Lago Cote Instituto Geográfico Nacional
JK
fl. 1952
Flight Lieutenant, Royal Air Force; Aircraft Captain
On the morning of September 19, 1952, Kilburn and nine other RAF personnel at RAF Topcliffe, Yorkshire watched a silver disc descend in a swaying "falling sycamore leaf" motion behind a returning Meteor jet, hover, rotate, and accelerate away at a speed he described as "in excess of that of a shooting star." His signed statement to the Air Ministry became the case's primary documentary record and, per Captain Edward Ruppelt, the sighting that "caused the RAF to officially recognise the UFO."
Royal Air Force; Aircraft Captain
The second qualified aircraft captain, alongside John Kilburn, among the ten witnesses to the September 19, 1952 sighting at RAF Topcliffe. His full first name has not surfaced in the sources reviewed, but his presence as an independent, professionally-trained second witness to the same sequence of events is one of the case's genuine corroborating strengths.
JP
fl. 1952
Flying Officer, Royal Air Force
Credited in multiple accounts with being the first of the ten RAF Topcliffe witnesses to spot the object in the sky behind the returning Meteor jet on September 19, 1952, before drawing the attention of John Kilburn and the rest of the group to it. Some secondary sources render his initials differently ("R.N. Paris").
Royal Air Force
A senior non-commissioned aircrew specialist among the ten witnesses to the September 19, 1952 sighting at RAF Topcliffe. As a Master Signaller, Thompson's trade required exactly the kind of careful, procedural observation and reporting the case's official file ultimately depended on.
WS
Captain, USAF; Exchange Pilot, No. 5 Squadron RAF, RAF Binbrook
A USAF officer with two Vietnam combat tours in the F-102 Delta Dagger, Schaffner was scrambled from RAF Binbrook on September 8, 1970 in Lightning XS894, callsign "Foxtrot 94," to intercept a TACEVAL exercise radar contact over the North Sea. He was killed when his aircraft struck the water, most likely after spatial disorientation during a low-level night shadowing maneuver; his ejector seat failed to fire due to a servicing fault and his body was never recovered. The dramatic "UFO interception" story now associated with his name was invented by an anonymous newspaper source in 1992, twenty-two years after his death, and is contradicted point for point by the declassified 1972 RAF Board of Inquiry report.
PT
1912 – 2012
Co-Witness; Educator and Community Leader, Las Cruces
Wife of astronomer Clyde Tombaugh, whom she married in 1934 while both attended the University of Kansas. On August 20, 1949, alerted by her husband's call, she and her mother watched the final second and a half of the six-to-eight-light rectangular formation before it faded from view, independently reporting what she took to be a faint glow connecting the individual lights. A University of Kansas philosophy graduate, she went on to a long career as a Las Cruces elementary school teacher and was a founding member of the city's Unitarian Universalist congregation.
VS
b. c. 1978
Primary Child Witness, Voronezh Landing (age 11 in 1989)
An eleven-year-old fifth-grader who was among the group of boys playing football in Yuzhny Park, Voronezh, on the evening of September 27, 1989, when the group first reported seeing a luminous red sphere descend into the park. Surin is the most consistently named of the child witnesses across contemporary Soviet press accounts, Western wire coverage, and later retrospectives, and his account — along with those of classmates Zhenya Blinov and Yulia Sholokhova — forms the evidentiary core of the case. Decades later, journalists locating the now-adult former schoolchildren of Yuzhny Park found a genuine range of reactions, from continued conviction that something extraordinary occurred to open acknowledgment that childhood imagination, peer pressure, and the sudden arrival of eager adult interviewers may have shaped and amplified an initially much vaguer observation. This site treats the child-witness testimony honestly as both the case's central evidence and its central vulnerability — see the Observer Credibility section of the case file for a full discussion.
Child Witness, Voronezh Landing (sixth grade in 1989)
A sixth-grade classmate of Vasya Surin who was present in Yuzhny Park, Voronezh, on September 27, 1989, and is named across multiple contemporary and retrospective accounts — including Jacques Vallee's field-research summary of the case — as one of the small group of boys who first described the red sphere and the emerging entities to local reporters and, subsequently, to Soviet television crews and Western wire journalists.
YS
Child Witness, Voronezh Landing
One of the schoolchildren present in Yuzhny Park, Voronezh, on September 27, 1989, named in contemporary Soviet press coverage and in Jacques Vallee's later field-research account of the case among the small circle of children whose testimony anchored both the original Kommuna newspaper article and the subsequent TASS wire report.
Killed in Action, HMAS Hobart
Closed up at HMAS Hobart's exposed anti-aircraft control position above the bridge when the first of three American air-to-air missiles struck the ship amidships in the early hours of 17 June 1968, killing him instantly. See the HMAS Hobart / DMZ Vietnam Incident case file.
Killed in Action, HMAS Hobart
Killed when the second salvo of American air-to-air missiles struck HMAS Hobart near the Ikara missile magazine in the early hours of 17 June 1968. See the HMAS Hobart / DMZ Vietnam Incident case file.
WB
Active 1968–present
Gunner, HMAS Hobart; Survivor
Serving on one of Hobart's gun mounts during the 17 June 1968 attack, Bastow later recalled that the ship's own crew fired at what they believed at the time was an enemy aircraft. In August 2018 he received permission to return to the approximate attack site at sea to hold a personal 50th-anniversary memorial service for Butterworth and Hunt. See the HMAS Hobart / DMZ Vietnam Incident case file.
TM
20th century
Sergeant, Liberty Township, Ohio Police Department
First officer to independently sight the object at close range on Samson Road shortly after midnight on December 14, 1994, Meloro reported that his patrol cruiser's engine, radio, and electrical systems failed completely as the object passed low overhead, restoring themselves only once it moved off. His account, delivered originally over a recorded police radio channel, anchors the Trumbull County case's most analytically significant minutes.
RR
20th century
911 Dispatcher, Trumbull County, Ohio
The dispatcher on duty for the bulk of the December 14, 1994 overnight wave, Rudolph fielded a rapidly escalating volume of simultaneous calls from civilians and patrol officers describing the same object, cross-checked competing descriptions in real time, and placed the calls to the FAA and the Youngstown Air Reserve Station that returned negative radar and flight-traffic results. Her recorded remark — "everyone in the county has a visual on it that I can hear" — is the case's most-cited line.
JB
20th century
Lieutenant, Brookfield Township, Ohio Police Department (off duty)
Monitoring escalating radio traffic from home during the December 14, 1994 Trumbull County wave, Baker drove out and climbed an abandoned regional radar tower for a better vantage point, reporting three objects arranged in a triangular formation cycling in unison through red, yellow, blue, and green — a description that both corroborates the wave's scale and complicates any single-object explanation.
RD
Active 1959
Police Officer, Redmond, Oregon Police Department
On overnight patrol shortly before dawn on September 24, 1959, Dickerson watched a large, bright object fall like a meteor over Redmond, Oregon, stop abruptly, and hover roughly 200 feet above the ground, close enough that nearby juniper trees appeared to glow in its light. He drove directly to the FAA's Redmond Airport office to seek a second, technically equipped observer, the decision that escalated a roadside sighting into a formal Air Defense Command response involving six F-102 interceptors.
LW
1950 – 2026
Original Witness; President, Shag Harbour UFO Incident Society
A 17-year-old local resident driving four friends home on Highway 3 near Shag Harbour, Nova Scotia on October 4, 1967, Wickens watched four amber lights descend into the harbour and made the original call to the RCMP. He spent decades afterward as the case's most consistent public witness, serving for many years as president of the Shag Harbour UFO Incident Society and helping organize the annual festival before his death in 2026 at age 76.
RP
Royal Canadian Mounted Police, Barrington Passage Detachment
The first RCMP officer to reach the shore at Shag Harbour, arriving roughly fifteen minutes after Laurie Wickens's call on the night of October 4, 1967, Pond personally observed the object's final moments on the water, later describing it as consistent with "no known object" he could identify — giving the case an early layer of professional, on-duty corroboration.
LS
Primary Civilian Witness, Varginha, Brazil
Teenager who, together with her sister Valquíria Silva and their friend Kátia Xavier, encountered a small, red-eyed, crouched being near a wall on a vacant lot in the Jardim Andere district of Varginha, Minas Gerais during a thunderstorm on the afternoon of January 20, 1996. Their account, given to press and later to Brazilian Army investigators within days, became the defining sighting of the entire case.
Primary Civilian Witness, Varginha, Brazil
Sister of Liliane Silva and one of the three teenagers who reported the January 20, 1996 creature sighting in Varginha's Jardim Andere district. Their mother, Luiza Helena de Silva, later told journalists she found an unusual three-toed footprint when she returned to the site with the girls.
KX
Primary Civilian Witness, Varginha, Brazil
The third of the three teenagers present at the January 20, 1996 Varginha sighting, Xavier gave the case's most granular physical description of the being — a heart-shaped face, oversized head, oily skin, three-fingered hands, V-shaped feet, and large red eyes — details that have anchored nearly every subsequent retelling of the case.
MC
1972 – 1996
Corporal, 24th Military Police Battalion, Minas Gerais
A 23-year-old soldier hospitalized February 12, 1996 for a pre-scheduled cyst removal, who died three days later of what his autopsy identified as post-surgical sepsis linked to a Staphylococcus schleiferi wound infection. His death, coinciding with the Varginha sightings, became the case's most persistent rumor of a UFO-related fatality; his family has alleged medical negligence and a rushed burial, though the documented medical record attributes his death to an ordinary surgical complication.
IV
Active 1996, 2025 – present
Neurosurgeon, Hospital Regional do Sul de Minas
A senior neurosurgeon who says he had a roughly four-minute face-to-face encounter with a non-human hospital patient on January 20–21, 1996, describing reddish, teardrop-shaped eyes, oily skin, and a perceived telepathic exchange. He did not go on the record in detail until 2025, following a near-fatal heart attack, and testified before members of the U.S. Congress in January 2026 alongside filmmaker James Fox's renewed investigation.
CS
Active 1996, 2025 – present
Ultralight Pilot & Geography Teacher
Reported following a distressed, cigar-shaped object to a rural crash site outside Varginha on January 13, 1996, where he says he recovered a self-reshaping metallic fragment before being confronted at gunpoint by military personnel and forced to leave. He did not speak publicly in detail for decades, citing alleged intimidation, before testifying to Congress and at the January 2026 National Press Club press conference.
LC
Active 1996
Biologist, Varginha Municipal Zoo
The zoo's biologist, who says firefighters approached her the night of January 20, 1996 asking her to accept "a very weird animal," and who later documented the unexplained deaths of several zoo animals — a tapir, an ocelot, a spider monkey, and two gray brocket deer — between February and April 1996. No independent laboratory report on those animal deaths has ever been publicly released.
LP
Local Resident Identified in the Army's Official Finding ("Mudinho")
A Varginha resident with a documented intellectual and physical disability, known locally by the nickname "Mudinho" for his habit of walking crouched over while collecting cigarette butts and sticks. The 1997 Military Police Inquiry's official conclusion identifies him, seen soaked and crouched against a wall during the January 20, 1996 thunderstorm, as the probable source of the three girls' misidentification, supported by a photographic comparison study in the official file.
RO
Active 1968
Airman First Class, 91st Minuteman Maintenance Squadron, USAF
One of the first two ground witnesses in the October 24, 1968 Minot Air Force Base UFO incident, O'Connor watched a light he first mistook for a farmyard lamp lift off and pace his and Lloyd Isley's truck near November-7 Launch Facility around 2:30 AM: "I noticed that farmer's yard light, and then I saw it raise up and start paralleling our truck going down the road." Minutes after the B-52's landing, he independently observed the Oscar-7 launch facility's security hatch standing open.
LI
Active 1968
Airman First Class, 91st Minuteman Maintenance Squadron, USAF
Traveling with Robert O'Connor toward November-7 Launch Facility during the October 24, 1968 Minot Air Force Base UFO incident, Isley independently corroborated the object's size and pacing behavior and separately reported a sound resembling jet engines and a color shift from white to green to dim amber during his own extended overnight observation.
WS
Staff Sergeant, Flight Security Controller, Oscar-1 Launch Control Facility, USAF
The first NCO to receive a ground sighting report during the October 24, 1968 Minot Air Force Base UFO incident, at 2:15 AM, and to observe the object himself fifteen minutes later. Smith coordinated the Security Alert Team's response to the Oscar-7 intrusion alarm at 4:49 AM and confirmed the site's gate lock had been defeated: "the lock was undone on the gate…we know somebody was on the site."
JJ
Active 1968
Airman First Class, Security Police, 91st Strategic Missile Wing, USAF
Dispatched from November-1 to N-7 around 3:30 AM during the October 24, 1968 Minot Air Force Base UFO incident, Jablonski independently reported a second object converging from the east and, uniquely among the ground witnesses, described numerous smaller points of light "like shooting stars but they were actually maneuvering" streaming from the main object toward Oscar Flight.
JW
1907 – 1990
Farmer, Emilcin, Poland
A 70-year-old lifelong farmer who reported being approached by two green-faced humanoid beings while driving his horse-drawn cart near Emilcin on May 10, 1978, and led aboard a hovering craft for an examination he estimated lasted about twelve minutes. Subjected to hundreds of hours of psychological, psychiatric, and background evaluation by a University of Łódź team, which found him sincere and not clinically suggestible. Maintained his account until his death in 1990.
AP
Age 6 in 1978
Corroborating Child Witness, Emilcin, Poland
Reported, along with his younger sister, seeing a bus-like aerial object at roughly barn height around 8:00 AM on May 10, 1978, approximately three-quarters of a mile from Jan Wolski's encounter site. His account emerged only after the case had drawn local attention, and researcher Bartosz Rdułtowski has questioned whether the investigator's own interview technique shaped his testimony.
Primary Witness, Age 28 — Trancas Case
The elder of two sisters visiting Finca Santa Teresa from Rosario, Argentina was the first to shine a flashlight at the nearest object during the October 21, 1963 sighting near Trancas, Tucumán. Investigator Oscar Galíndez's own contemporaneous assessment characterized her account as the most prudent and measured of the three sisters'.
Primary Witness & Family Spokesperson — Trancas Case
The younger visiting sister and, by most later accounts, the Moreno family's principal spokesperson for the October 21, 1963 Trancas Case. She gave the most detailed and elaborated testimony of the three sisters, later stated she personally authorized elements of the family's account for Close Encounters of the Third Kind, and remained the case's last surviving direct adult witness into the 2020s.
Resident Sister, Finca Santa Teresa — Trancas Case
The sister already living at the Moreno family's rural property at the time of the October 21, 1963 sighting, present for the full encounter alongside Argentina and Yolié. Investigator Oscar Galíndez characterized her account as comparatively disorganized but sincere.
Domestic Employee, Age 15 — First Witness, Trancas Case
The Moreno household's teenage employee was first to notice the unusual lights and noises near the rail line on October 21, 1963 and alerted the sisters. During the encounter she suffered first- and second-degree burns to her face, arms, and legs, treated the next day by Dr. René Vera at the Trancas hospital — the case's only reported physical injury.
Father, Age 72 — Trancas Case
The Moreno family patriarch was drawn into the October 21, 1963 encounter as it escalated, becoming a witness to its later stages from the house and yard at Finca Santa Teresa alongside his wife, Teresa Kairuz de Moreno.
Mother, Age 63 — Trancas Case
Present at Finca Santa Teresa throughout the October 21, 1963 encounter, Teresa was among the household members drawn outside or to the windows as the sighting intensified, corroborating the family's account from a second vantage point on the property.
Ranch Foreman, Finca Santa Teresa — Trancas Case
The property's foreman was present during the later stages of the October 21, 1963 sighting alongside the Moreno parents, one of nine named witnesses to the case.
Neighboring Farmer — Independent Witness, Trancas Case
Observing from his own property near the Moreno finca, Tropiano independently reported unusually intense lights over the same sector of the General Belgrano rail line on the night of October 21, 1963, with no family or economic tie to the Morenos — among the case's strongest corroborating accounts.
Physician, Trancas Hospital — Independent Witness, Trancas Case
The doctor who treated Dora Guzmán's burns reported, on the night of October 22–23, 1963, independently observing several dozen similar lights over the same rail corridor near Trancas, along with the same sulfur-like odor the Moreno family described.
BD
Bob: 1938–2024
Original Witnesses & Airfield Owners, Carman, Manitoba
Walking from their farmhouse to their private grass airstrip — later formally named Friendship Field — on the night of April 10, 1975, Bob and Elaine Diemert watched a pulsing, dome-topped red light approach from the west, veer north, and travel just above the treetops at roughly 50 km/h, the first documented sighting of what would become the Charlie Redstar wave. Nightly sightings began at their field a month later, and the couple hosted the informal "UFO-watching parties" that drew hundreds of neighbors and out-of-town visitors through the summer of 1975. Bob Diemert was already a locally and internationally known figure well before 1975: a self-taught engineer and one of the first serious warbird restorers in North America, he rebuilt a Hawker Hurricane (one of only five flyable examples in the world at the time) and flew it as a stunt aircraft in the 1968 film Battle of Britain, later recovered and restored Japanese Imperial Navy aircraft from South Pacific battlefields, and in the 1980s designed and built the Diemert Defender, an original low-cost fighter prototype that was the subject of the 1989 National Film Board documentary The Defender. He continued operating Friendship Field and speaking publicly about Charlie Redstar for the rest of his life, appearing alongside researcher Grant Cameron at UFO conferences into the 2010s, until his death in January 2024 at age 85.
IN
Royal Canadian Mounted Police, Carman Detachment
An on-duty RCMP constable who responded to a Charlie Redstar report and observed the object directly, describing "an oval red light, surrounded with an X-shaped white halo" that held stationary for two to three minutes before he attempted to close the distance by car; as he drove west the object appeared to shift to a northeasterly heading, and he pursued it for approximately twelve miles along the area's grid-pattern gravel roads without ever closing the gap. His account is one of the case's few sightings by a trained, on-duty law-enforcement observer rather than a civilian bystander.
RP
Active 1975
Commercial Airline Pilot
A professional airline pilot who reported watching a light approach his position on what he described as a steep angle before abruptly reversing course: "It was flying on a 45-degree angle, but it was still flying straight at us... it just went directly the other way straight away from us. It just went off into the distance away from us, and a puff of smoke appeared — an odd shape, like a small cloud, and it disappeared in that." As a trained aviator accustomed to judging the relative motion and closing speed of other aircraft, his account is treated by researchers as carrying more evidentiary weight than an untrained ground observer's, though it remains a single uncorroborated visual sighting with no radar or instrument backing.
Delivery Driver (Primary Witness)
A 25-year-old Cuban-born tradesman working as a delivery driver in Venezuela, González physically grappled with a small, hairy, clawed humanoid beside a hovering luminous sphere in Petare in the early hours of November 29, 1954, sustaining bruising and a scratch later documented by X-ray. He reported the encounter to Transit Police within roughly thirty minutes and later declined a proposal to undergo hypnosis and sodium pentothal testing.
Delivery Assistant (Primary Witness)
Gustavo González's Venezuelan-born assistant on their predawn delivery route, Ponce witnessed the November 29, 1954 Petare encounter alongside González, observing additional beings emerging from nearby bushes before the object departed, and corroborated the account to Transit Police the same night.
Artist (Primary Witness)
One of two identical twin brothers who, alongside Chuck Rak and Charlie Foltz, witnessed a pulsating sphere of light descend toward their canoe on Eagle Lake on August 20, 1976. An internationally exhibited artist trained at the Massachusetts College of Art, Jack independently reported nightmares nearly identical to his twin brother Jim's beginning around 1987–1988, and later presented with unexplained burn-like marks on his feet and a scoop-mark scar on one ankle around the time of his 1989 hypnotic regression sessions. He has never wavered from the full account.
Artist (Primary Witness)
Jack Weiner's identical twin, and the member of the group whose recurring nightmares of large-headed, black-eyed beings — which began around 1987–1988 alongside a diagnosis of temporal-lobe epilepsy — directly triggered the formal investigation into the August 20, 1976 Eagle Lake sighting. Jim approached investigator Raymond Fowler in 1988 and remained the case's central figure through the hypnotic regression sessions that followed, remaining connected to the ceramics program at his and his brother's alma mater, the Massachusetts College of Art, and continuing to give interviews about the case as recently as 2024.
Artist (Witness; later recanted)
A member of the four-man group that witnessed the August 20, 1976 Eagle Lake sighting, trained alongside Jack and Jim Weiner at the Massachusetts College of Art. Rak affirmed the abduction narrative for decades before stating publicly, in a 2016 interview, that the abduction elements had been fabricated for financial gain, while continuing to affirm that he personally witnessed genuinely strange lights during the trip. His recantation directly contradicts the impression left by his own earlier public statements and remains one of the case's most significant pieces of counter-evidence.
U.S. Navy Veteran & Artist (Primary Witness)
A Navy veteran who returned to civilian life to complete his art education alongside Jack and Jim Weiner and Chuck Rak at the Massachusetts College of Art, and who functioned informally as the group's wilderness guide on their August 1976 canoe trip. Foltz was the member of the group who signaled the hovering object with a flashlight moments before the beam and the missing-time interval on Eagle Lake. He has continued to affirm the full account into the 2020s, including in a 2024 podcast interview alongside Jim Weiner.
MT
Airman, Security, Capehart Housing Gate, Wurtsmith AFB
The Wurtsmith case's first reporting witness, at approximately 2210 hrs on October 30, 1975. Tackabury described a low-flying object with one downward-pointing white light and two red lights near its trailing edge from his post at the Capehart family-housing gate.
MM
Active 1975
Airman, Air Policeman, Main Gate / Motor Pool, Wurtsmith AFB
Independently reported several lights near the base's western perimeter within minutes of Martin Tackabury's report, from a separate vantage point near the main gate and motor pool.
RA
Sergeant, Motor Pool, Wurtsmith AFB
Reported the object moving more slowly than a KC-135 tanker simultaneously visible in the same area — a comparative reference point that helped establish early on that the intruder's flight profile did not match a fixed-wing aircraft.
RS
Active 1975
Airman, Security, Main Gate, Wurtsmith AFB
Corroborated the general pattern of perimeter sightings from his own post at Wurtsmith's main gate during the same October 30, 1975 window.
JM
Active 1975
Sergeant, Security, Weapons Storage Area, Wurtsmith AFB
Among the guards posted directly inside Wurtsmith's nuclear weapons storage area who reported the object hovering at low altitude, lights initially dark, making a sound described as similar to a helicopter — the report that escalated the incident to a security emergency.
SS
Named Witness, Wurtsmith AFB (Duty Position Not Specified in Sources Consulted)
Identified by rank and name in the surviving secondary compilations of the October 30, 1975 case, without a specified duty position in any source located.
DL
Active 1975
Staff Sergeant, 42nd Security Police Squadron, Loring AFB
The Loring case's first witness. Patrolling the weapons storage area's northern perimeter on the evening of October 27, 1975, Lewis spotted an unidentified object descending toward the base's nuclear weapons igloos at an estimated 150–300 feet, showing a red navigation light and white strobe, and reported it up the chain of command — the report that triggered a Security Option 3 alert within minutes.
JS
Active 1975
Staff Sergeant, Radar Operator, 2192nd Communications Squadron, Loring AFB
First detected the unknown radar return roughly 10 to 13 miles east-northeast of Loring AFB on the night of October 27, 1975, handing off to Grover K. Eggleston for the sustained 40-minute track that followed. His instrument-literate, on-duty account anchors the case's primary radar record.
GE
Sergeant, Radar Operator, 2192nd Communications Squadron, Loring AFB
Sustained the base radar's roughly 40-minute track of the unidentified object on October 27, 1975, watching it circle before it abruptly vanished from the scope on a bearing toward Grand Falls, New Brunswick.
Captain, Malmstrom Air Force Base, Montana
The officer named in the surviving message traffic as having notified the Air Force Office of Special Investigations (AFOSI) on November 7, 1975, after a Sabotage Alert Team's report of a "football field"-sized glowing disc over the K-7 Minuteman missile site — the moment a local security incident became an AFOSI-tracked case within the wider 1975 SAC Base Intrusion Wave.
Brigadier General, Deputy Director for Operations, National Military Command Center (NMCC)
Signed the November 8, 1975, 6 a.m. EST National Military Command Center memorandum compiling NORAD height-finder radar cuts (9,500–15,500 feet) and multiple missile-site visual reports from the Malmstrom AFB, Montana missile field — the Pentagon-level paper trail that moved the incident from a base security log into a documented NORAD Combat Operations Center record.
CB
Sergeant, 42nd Security Police Squadron, Loring AFB
Corroborated Staff Sgt. Danny K. Lewis's initial October 27, 1975 sighting independently as part of the security sweep that followed, adding same-shift, multi-witness backing from a trained perimeter guard to the base's first-night account.
WL
Active 1975
Staff Sergeant, 42nd Security Police Squadron, Loring AFB
Corroborated the October 27, 1975 weapons-storage-area sighting alongside Sgt. Clifton W. Blakeslee as part of the same security sweep, one of several independent on-duty perimeter guards to report the intrusion that night.
SE
Active 1975
Sergeant, B-52 Crew Chief, 42nd Bomb Wing, Loring AFB
Gave the Loring case's single most detailed close-range account: on October 28, 1975, with Sgt. R. Jones, he observed a silent, reddish-orange, cigar-shaped object — a "stretched-out football" — hovering roughly five feet above the ground near the runway, describing a heat-shimmer-like visual distortion around it and specifically noting the absence of any doors, windows, propellers, or engines.
AB
Served 1970–1976
Security Police Shift Commander, Loring AFB
Interviewed decades after the events, Beers recalled receiving escalating shoot orders during the October 1975 intrusions and stated the object returned on "three other nights" beyond those most thoroughly documented in the contemporaneous message traffic. He separately recalled an F-106 interceptor being launched without achieving contact, a detail not fully reconciled with the surviving record of a declined NORAD fighter request.
MW
Active 1975
KC-135 Tanker Pilot, Loring AFB
Recalled being briefed on the October 1975 incursion over Loring's nuclear-armed B-52s and weapons storage facilities, describing a silent, luminous object capable of rapid straight-line and vertical movement with no apparent turning radius, and recalled personnel using the term "UFO" openly in official briefings rather than avoiding it.
JM
Served 1972–1975
Hospital Corpsman, Loring AFB
Recalled overhearing aircrew tell an officer that nothing on Earth could perform the way the object intruding on Loring's weapons storage area did — a secondhand but vivid piece of base-wide oral testimony about how seriously flight and aircrew personnel treated the October 1975 intrusion at the time.
TR
b. 1960
Primary Witness & Abduction Claimant (Primary Witness)
Nine years old on September 1, 1969, Reed says his family's car was engulfed in light while crossing the Old Covered Bridge in Sheffield, Massachusetts, and that they were taken aboard a craft and examined by insect-like beings inside a hangar-like interior. Reed has publicly advocated for the case since the mid-2000s, founding the nonprofit behind the Sheffield monument park, and in 2024 revised his account to attribute the incident to unspecified government actors rather than an alien species.
Primary Witness (Thom Reed's Brother)
Six years old in 1969, Matt Reed is his brother Thom Reed's co-witness across the family's three claimed encounters (1966, 1967, 1969). His own recollection of the 1966 and 1967 childhood incidents was not continuous; by his account, an unrelated 2009 encounter on a rural Indiana road triggered the earlier memories to resurface some 40 years after the events they describe.
MK
Witness, Lake Mansfield, Great Barrington (Primary Witness)
Fourteen years old on September 1, 1969, Kirchdorfer reported a bright light engulfing her family's car at Lake Mansfield in Great Barrington, separate from and unconnected to the Reed family's bridge encounter that same night. Per Benjamin Radford's 2024 Skeptical Inquirer investigation, her more detailed memories of levitation and an onboard examination room were "elicited retroactively and through recovered memories," and she did not begin comparing accounts with fellow witness Tom Warner until a chance 2018 meeting, 49 years later.
TW
Active 1969
Witness, Family Property, Berkshire County (Primary Witness)
Reported an object roughly 20 feet in height and 30–40 feet around, exhibiting unfamiliar colored lights, from his own family's property on September 1, 1969, independent of the Reed family and Melanie Kirchdorfer's locations. Warner has kept a comparatively lower public profile than Thom Reed and did not begin actively cross-referencing his account with Kirchdorfer's until they met by chance in 2018.
VV
Translator; Primary Witness & Photographer, Greifswald Lights
A professional translator living in Greifswald whose wife first noticed a crowd gathering outside their apartment building on the evening of August 24, 1990. Vinogradov photographed the "ring of seven" formation with a Zenith-E camera at the exact moment two objects joined a group of three already-present lights, and separately captured a photograph of nearby apartment-window lighting that MUFON-CES later used for brightness-comparison photometry. He has publicly described "glowing balls which hung in a strange formation in the sky" that "all appeared to rotate and hover, but in a stable and controlled type of fashion," and states that hundreds of witnesses saw the same event.
Physician; Primary Videographer, Greifswald Lights
A medical doctor who, with her husband, project engineer Nicolai Ivanov, filmed the "Y-formation" for roughly four continuous minutes from their own third-floor Greifswald balcony using an Orion video camera. Their footage — capturing the group's evolution from four to seven objects and the unexplained 8:47 PM flash near the formation — forms one of the two technically most important video sources in Illobrand von Ludwiger's MUFON-CES analysis of the Greifswald Lights case.
RL
Witness & Photographer, Trassenheide, Isle of Usedom
Photographed both light formations from the beach at Trassenheide on the Isle of Usedom with a 300x-zoom Yashica camera during the Greifswald Lights sighting. His deliberately underexposed manual-exposure photograph became the single most useful image for MUFON-CES's computer contrast-enhancement work, ultimately yielding the case's 12 ± 2 meter sphere-diameter estimate, while a separate photograph of the lights reflected in the water was used by investigators to rule out a mirage explanation.
Senior Private-Company Executive; Primary Witness & Filmer
A senior executive at a private company who filmed a bright, multi-coloured, shape-shifting object from his own tenth-floor flat in Kalikapur, east Kolkata, for roughly three hours in the pre-dawn hours of October 29, 2007. His handycam footage, broadcast on Kolkata television, is the sole piece of physical evidence in the Kolkata UFO Sighting and drew hundreds of onlookers to the E.M. Bypass. This individual shares a name with a well-known Indian film actor and director but is a distinct, unrelated private citizen; no source connects the two.
YY
fl. 2007–2009
Night Watchman, Yeni Kent Compound; Sole Filmer
A night security watchman at the Yeni Kent Compound near Kumburgaz, Istanbul, who over three years (2007–2009) filmed more than two dozen videos of luminous crescent- and disc-shaped objects over the Sea of Marmara using progressively upgraded consumer and infrared-adapted cameras. He presented his footage publicly for the first time at the 2009 International UFO Congress in Istanbul. He remains the sole source of every recording in the Yeni Kent Compound Sighting; no independent filmer or witness ever corroborated any of his footage.
AA
Casablanca Resident; Former Pilot
The only individually named witness in the CIA's declassified "Unidentified Flying Objects Over Morocco and French West Africa" file. On June 16, 1952, Assini, a former pilot living in Casablanca, reported a flying-saucer sighting to the local press. Contemporary accounts state his report was checked against French Meteorological Bureau records, which turned up no conventional explanation — the closest thing to independent corroboration anywhere in the case.
Duty Meteorological Observer, RAF Shawbury
An eight-year veteran Met Office observer on duty at RAF Shawbury who, at around 2:40 a.m. on March 31, 1993, reported a large triangular craft approaching the station at low altitude and roughly 30–40 mph, sweeping a narrow beam of light across a field beyond the perimeter fence and emitting a low hum before departing at speed — the account Nick Pope found most compelling from the entire Cosford Incident. Elliott later told researcher David Clarke he had been considerably more ambivalent about the sighting than Pope's later retelling suggested, and, after learning a Dyfed-Powys Police helicopter had been using its NiteSun searchlight nearby during a vehicle pursuit at almost exactly that time, concluded: "it's clear in hindsight that what I saw was not the same object seen at Cosford as it was much later."
Conscript Sentry, Talavera la Real Air Base
Performing compulsory military service, Trejo was on overnight sentry duty in the fuel-storage zone of Talavera la Real Air Base on November 12, 1976 when he and a fellow sentry reported a piercing interference-like whistle followed by a three-meter luminous humanoid figure at the perimeter. Trejo reported sudden paralysis and chest pain as he tried to raise his weapon, and suffered the case's most serious documented aftermath — weeks of recurring temporary blindness, hospitalization in Badajoz and then Madrid's Hospital del Aire, and more than sixty subsequent interrogations, including an accusation of drug use he has always denied. He has maintained a materially consistent account for nearly five decades, giving an on-record interview marking the case's 50th anniversary in 2026.
Conscript Sentry, Talavera la Real Air Base
Posted in a separate guard hut roughly sixty meters from José Manuel Trejo, Carrizosa Luján independently reported the same precursor whistling and radio-like interference before either soldier had visual contact with the entity later described at the base's fuel-depot perimeter. One of the two sentries who opened fire on the figure with his service submachine gun. Now deceased.
Military Dog Handler, Talavera la Real Air Base
Joined José Manuel Trejo and Juan Carrizosa Luján during the perimeter inspection that led to the 1976 sighting, bringing his German shepherd patrol dog, whose sudden, disoriented reaction near the encounter site is one of the case's few non-human behavioral data points. Also fired on the figure alongside Carrizosa Luján. Now deceased.
Duty Corporal, Talavera la Real Air Base
The duty non-commissioned officer on shift the night of November 12, 1976, Pavón was alerted by sentries reporting an unexplained whistle and light and ordered the perimeter inspection that led directly to the humanoid encounter. No further biographical detail about Pavón has surfaced in the case's available secondary literature.
General Practitioner, Gáldar, Gran Canaria
A licensed physician from Gáldar with no prior involvement in ufology, Padrón León gave the single most sensational account inside the June 22, 1976 Gando Air Base / Canary Islands UFO sighting: a transparent, electric-blue sphere near the Piso Firme road containing two red-suited humanoid figures at consoles. His account was contradicted by his own taxi companion(s), who reported only the same distant light display seen across the archipelago that night, and he declined the Spanish Air Force investigating officer's request for hypnotic regression. A later researcher found no independent corroboration and characterized him as showing "a personality with fantasy tendencies."
Royal Canadian Mounted Police, Clarenville Detachment
The 25-year-old RCMP constable who responded to a Marine Drive resident's call just before 2:00 a.m. on October 26, 1978, and became the Clarenville UFO Sighting's central witness. Retrieving the detachment's high-powered surveillance telescope, Blackwood watched a large, dull-grey, fin-tailed object hover a few hundred feet above Random Island's waters for nearly two hours, reporting that its underside light flashed in apparent response when he activated his cruiser's roof lights. He gave roughly 200 media interviews in the encounter's aftermath, endured years of ridicule as a result, and has maintained a consistent account across a contemporaneous 1978 television interview and subsequent retellings, including a 2020 interview timed to the Royal Canadian Mint's commemorative coin. Now retired and living in Nova Scotia, he has said simply: "I still can't say what it was…It definitely was not a star."
CL
Marine Drive Resident, Clarenville, Newfoundland and Labrador
The Marine Drive resident whose call to the Clarenville RCMP detachment, made with his wife shortly before 2:00 a.m. on October 26, 1978, first brought Constable James Blackwood to the scene of the Clarenville UFO Sighting. Lethbridge handed Blackwood his own binoculars for a closer look at the object and watched alongside the officer and several other neighbours for part of the nearly two-hour encounter, but left before it ended, telling Blackwood he did not want to "make contact" with whatever was producing the light.
Officer-on-Duty, Signal Center, Soviet Army
The most detailed witness in the Kapustin Yar UAP Sighting. On the night of July 28–29, 1989, Voloshin received a telephone report of a "flying saucer" over his unit, confirmed it through his own chain of command, then climbed an antenna tower with Private Tishchayev to observe a disc-shaped, dome-topped object for a continuous two hours. His handwritten deposition and hand-drawn sketch of the object — the case's only surviving graphical record — were preserved in the KGB's declassified "Blue Folder" and reproduced in the Moscow magazine Aura-Z in 1993.
Enlisted Soldier, Soviet Army Signal Center
Climbed an antenna tower alongside Ensign Voloshin during the Kapustin Yar UAP Sighting of July 28–29, 1989, to directly observe the reported disc-shaped object hovering over the unit's rocket weapons depot. His own KGB deposition is recorded as substantially confirming Voloshin's account.
LK
Officer, Second Military Unit, Soviet Army
Alerted the guard shift of Corporal Levin and three privates to the object(s) reported during the Kapustin Yar UAP Sighting at a neighboring military unit. Klimenko's own KGB deposition provides the case's most specific account of a failed jet-fighter intercept, describing an aircraft he identified by engine noise that could not close on the object before it "disengaged so fast, that it seemed the plane stayed in one place."
CL
Senior Enlisted Witness, Guard Shift, Soviet Army
The senior enlisted member of the guard shift alerted by 1st Lt. Klimenko during the Kapustin Yar UAP Sighting, filing an independent KGB deposition describing up to three objects performing rapid, triangulating movements and abrupt color changes.
PB
Enlisted Soldier, Guard Shift, Soviet Army
One of the four enlisted privates on the guard shift who independently corroborated the Kapustin Yar UAP Sighting, filing his own KGB deposition describing the object's abrupt acceleration and physically "felt" approach.
PK
Enlisted Soldier, Guard Shift, Soviet Army
One of the four enlisted privates on the guard shift who independently corroborated the Kapustin Yar UAP Sighting, filing his own KGB deposition describing the object's changing colors and erratic stop-and-jump flight pattern.
PL
Enlisted Soldier, Guard Shift, Soviet Army
One of the four enlisted privates on the guard shift who independently corroborated the Kapustin Yar UAP Sighting, part of the group whose depositions describe up to three objects and a failed jet-fighter intercept.
AM
1928 – 2020
Fiorentina & Italy National Team Defender; 1954 FIFA World Cup Squad
Born in Pistoia on October 21, 1928, Magnini began in the youth ranks of Pistoiese — the very club Fiorentina was hosting on October 27, 1954 — before signing for Florence's club in 1950. Over eight seasons he made 225 league appearances and anchored the defense that won Fiorentina's first Scudetto in 1955–56 and reached the 1957 European Cup final, while also winning 20 caps for Italy, including two appearances at the 1954 FIFA World Cup in Switzerland that same summer. A starting defender on the pitch for the Florence Stadium Sighting, Magnini remained one of the case's most consistent on-record eyewitnesses across six decades of interviews, describing "something that looked like an egg, moving slowly, slowly, slowly" with silvery fragments falling from the sky. He died in Florence on July 3, 2020, at 91.
GB
active 1954
Fiorentina Supporter
A Fiorentina fan among the roughly 10,000 spectators at the Stadio Comunale on October 27, 1954, remembered in retrospective press coverage chiefly for describing the object overhead as shaped "like a Cuban cigar" — one of several genuinely divergent first-hand shape descriptions (egg, disc, "seagull wings," a Chinese mandarin hat) that make the Florence Stadium Sighting's witness record internally inconsistent on this specific point. No further biographical detail about Boni beyond this account is publicly documented.
GB
1922 – 2009
Chief Reporter & Correspondent, La Nazione
Born in Reggello, near Florence, on August 25, 1922, Batini earned a law degree before becoming one of the defining figures of twentieth-century Tuscan journalism, spending more than fifty years at La Nazione — eventually as its chief reporter — and authoring over fifty books on Tuscan history and folklore. His own newsroom received the first reports of the October 27, 1954 sighting, and per multiple retrospective accounts, staff climbed onto the paper's own roof in central Florence to watch the phenomenon directly as it was described unfolding over the city, placing La Nazione's senior reporter among the first-hand witnesses whose coverage anchored the Florence Stadium Sighting's contemporary record. He died in Florence on April 7, 2009, at 87.
AJ
University of Florence Engineering Student
An engineering student who, in the minutes after the October 27, 1954 sighting, managed to gather a handful of the fibrous "bambagia silicea" ("angel hair") material before it dissolved, reporting it to La Nazione's newsroom around 14:30 and ultimately delivering the sample to the University of Florence's Institute of Analytical Chemistry — the action that produced the only scientifically analyzed physical sample connected to the Florence Stadium Sighting. No further biographical detail about Jacopozzi beyond this role is publicly documented.
AM
1909 – 2006
Olympic Long Jumper; Fiorentina Assistant Coach & Athletic Trainer
Born in Viareggio on November 9, 1909, Maffei was one of Italy's leading track-and-field athletes of the 1930s, winning eight Italian long-jump championships — still a national record for the event — and competing directly against Jesse Owens in the long-jump final at the 1936 Berlin Olympics, where his 7.73m Italian record missed the bronze medal by a single centimeter and stood unbeaten for 32 years. After retiring from competition he moved into football conditioning, serving as Fiorentina's assistant coach from 1952 to 1955 under Fulvio Bernardini and later as athletic trainer for the Italian national team at Coverciano. In that capacity he was serving as the informal match official for the October 27, 1954 Fiorentina–Pistoiese friendly at the center of the Florence Stadium Sighting when he halted play so players could look up at the sky. He died in 2006.
CC
fl. 2016–present
Primary Witness, Pentyrch UFO Incident
A resident of Pentyrch, South Wales, Clarke says she and a neighbor were drawn to fields near Garth Mountain in the early hours of February 26, 2016 by a huge pyramid of red lights, followed by ejected colored lights, military helicopters, and two loud explosions. Over the following eight years she pursued a sustained Freedom of Information campaign against the Ministry of Defence and Welsh Government with investigator Gari Jones, co-authoring the 2021 book The Pentyrch Incident: The Greatest UFO Cover-up of Modern Times and taking three self-arranged polygraph examinations. Skeptical researchers have separately noted Clarke's own pre-incident public interest in UFO and CE-5 content as a documented basis for concern about confirmation bias in her account.
JO
Lieutenant (later Commodore), Royal Australian Navy
A 25-year-old RAN fighter pilot attached to HMAS Albatross, Nowra, O'Farrell was returning from a routine night cross-country exercise in a Hawker Sea Fury on August 31, 1954 when he watched two bright, unidentified lighted objects cross his flight path near Goulburn and take up station off his wing — a sighting independently confirmed in real time by ground radar operator Keith Jessop in the Hawker Sea Fury Sighting. He went on to a 37-year Navy career logging more than 4,500 flying hours, retiring as Commodore after a final posting as Naval Attaché in Washington, D.C. Dr. J. Allen Hynek personally interviewed him in 1973 and told him his sighting "cannot be explained away." O'Farrell gave a consistent account for the rest of his life and died in 2017.
KJ
fl. 1954
Petty Officer, Ground-Controlled-Interception Radar Operator, Royal Australian Navy
The G.C.I. radar operator on duty at HMAS Albatross, Nowra on the night of August 31, 1954, Jessop independently confirmed three simultaneous radar echoes — Lieutenant James O'Farrell's own Sea Fury plus two additional, unidentified returns — at a bearing and range matching O'Farrell's own visual sighting in the Hawker Sea Fury Sighting. His written report, filed September 2, 1954, and his later on-record statement that the returns "wouldn't have got a radar echo…if it had not been a substance that reflected our radar beams," remain the case's clearest technical evidence that the sighting was not a purely subjective, visual-only event. He was interviewed alongside O'Farrell for the 1993 television recreation of the case.
Farmer, Langenburg, Saskatchewan
A 36-year-old farmer swathing a rapeseed field on the morning of September 1, 1974, Fuhr shut down his machine and approached within roughly 15 feet of five hovering, rotating, metallic saucer-shaped objects at the edge of a slough on his land — the sighting at the center of the Langenburg UFO / Saucer Nests case. RCMP investigator Ron Morier described him as "the last guy in the world" likely to fabricate a hoax, and Fuhr maintained a materially consistent account across decades of repeat interviews, declining to profit from the story beyond a single complimentary CTV studio appearance. Fifty years later, in 2024, the Royal Canadian Mint commemorated his sighting with an official silver coin.
Farmer; Brother of Edwin Fuhr, Langenburg, Saskatchewan
Brother of primary witness Edwin Fuhr, Leo was among the first family members to reach the field after the September 1, 1974 sighting, independently describing the five doughnut-shaped ground impressions he found there. Fifty years later, following the Royal Canadian Mint's 2024 commemorative coin, Leo returned to the field with CBC News, telling reporters "seeing is believing" after revisiting the site of the Langenburg UFO / Saucer Nests case.
RB
1929 – 1977
Basketball Coach, Clearwater High School
Bone's February 21, 1973 sighting — witnessed alongside five of his own players while driving home from a game near Piedmont, Missouri — is the specific incident most consistently credited with drawing national attention to the wave that would become the Piedmont Missouri Wave and prompting Harley Rutledge's decision to organize a scientific field study. Bone was diagnosed with amyotrophic lateral sclerosis roughly six months later and died in 1977 at age 48; Rutledge's 1981 book, Project Identification, is dedicated to his memory.
EW
fl. 1973
Truck Driver, Greenville, Missouri
Webb's October 3, 1973 account of a blinding flash near Piedmont, Missouri that melted and dislodged the lens of his eyeglasses produced the only physical-trace evidence in the Piedmont Missouri Wave. His wife, present at the time, corroborated the immediate aftermath though she did not see the object herself. Researchers later reproduced the frames' melted appearance with an ordinary highway flare, though a consulted ophthalmologist doubted that explanation fully accounted for Webb's separately reported temporary blindness, leaving the incident honestly unresolved.
GL
Active 1950s
Self-described delegation member; correspondent of Borderland Sciences Research Associates
The sole source for the "Muroc"/Eisenhower meeting legend: in an April 16, 1954 letter to Meade Layne, director of Borderland Sciences Research Associates, Light claimed to have just returned from Muroc Dry Lake (Edwards Air Force Base) as part of an informal delegation that supposedly witnessed "five separate and distinct types of aircraft being studied and handled by our Air Force officials — with the assistance…of the Etherians." Light predicted a presidential announcement confirming contact "about the middle of May" 1954 that never came. No other named witness, official record, or corroborating account of the alleged meeting has ever surfaced; the claim rests entirely on Light's own letter and is treated by this site as an unverified legend, not a credible incident, distinct from the separately documented Edwards AFB Canberra Photograph case from the same year and location.
JS
Primary Witness & Videographer, Twin Shores Campground, PEI (June 4, 2014)
A camper from Moncton, New Brunswick, Sheppard was extinguishing a bonfire with his wife at Twin Shores Campground near Kensington, Prince Edward Island, when he noticed a diamond-shaped arrangement of flashing lights hovering low over the Gulf of St. Lawrence. He filmed roughly eight minutes of the object on his cellphone, narrating in real time that it reminded him of “a dreidel or a spin top,” and submitted the footage to the Mutual UFO Network of Canada, which investigated it as MUFON Case #57090 and closed it as an Unknown — the subject of this site's John Sheppard Sighting case file. No independent, non-family witness has ever corroborated his account.
ER
Atomic Energy Commission Security Patrol Trooper, Oak Ridge, TN
An AEC-employed security trooper who, alongside civilian caretaker John Moneymaker, observed two shiny silver, bullet/bladder-shaped objects dive with a smoke trail near Solway Gate during the October 1950 Oak Ridge wave, one of the incidents Knoxville radar independently corroborated the same afternoon. His account was among those the Army's Counter Intelligence Corps specifically background-checked and found no reason to discredit.
JM
Caretaker, University of Tennessee Research Farm
A civilian caretaker at the University of Tennessee's research farm adjoining the Oak Ridge control zone, Moneymaker witnessed the October 1950 Solway Gate sighting alongside AEC Trooper Edward D. Rymer, independently corroborating the object's diving, smoke-trailing approach from a non-security civilian vantage point.
JI
fl. 1950
Atomic Energy Commission Security Guard, Oak Ridge, TN
An AEC security guard who twice observed, on October 16, 1950, a silver-white sphere spinning about its own axis at roughly 2,000 feet over the K-25 plant — the cleanest single-witness sighting of the wider October–December 1950 Oak Ridge wave, loosely corroborated by an intermittent ground-radar return over the same restricted zone.
LR
Superintendent of Security, X-10 Control Zone, Oak Ridge, TN
The senior security official for Oak Ridge's X-10 (Graphite Reactor) control zone, Riordan observed a gunmetal-gray, balloon-like object on October 20, 1950, candidly suspecting a deflated weather balloon at first before actively ruling that out and filing the sighting as unidentified — a self-skeptical account this site's Oak Ridge case file treats as a genuine credibility point.
WF
Assistant Chief of Security, Project NEPA, Oak Ridge, TN
Assistant Chief of Security for the Nuclear Energy for the Propulsion of Aircraft program, Fry, together with his wife and son, observed the October 1950 Oak Ridge wave's longest single sighting on October 24 — a light cycling from red to orange to brilliant blue over roughly 33 minutes, independently matched almost minute-for-minute by a simultaneous ground-radar track.
DP
fl. 1950
Illustrator, Project NEPA Division, Oak Ridge, TN
A technical illustrator for the Nuclear Energy for the Propulsion of Aircraft program who, on November 5, 1950, observed a translucent, light-grey object rapidly changing outline "from a pear shape to a bean shape," revising his initial assumption of a balloon once its shape changes and darting movements contradicted that explanation; Project Blue Book's surviving index lists the sighting Unidentified.
ET
U.S. Army Officer
An Army colonel who reported an intermittent noise "like the blast of a jet" near Oak Ridge at 5 AM on October 26, 1950, with no aircraft visible — a report echoing similarly unexplained "strange, loud noises" security guards had separately described on the evening of October 16.
Boy Scout Troop Leader; Hardware Store Clerk, West Palm Beach, Florida
The sole witness to the alleged craft in the August 19, 1952 Sonny DesVergers Scoutmaster Case, claiming a hovering disc engulfed him in a ball of red fire in a palmetto thicket off Military Trail. Initially struck Edward Ruppelt's Project Blue Book team as credible, but his credibility collapsed once investigators uncovered a concealed Marine Corps discharge for AWOL and auto theft, a term in a federal reformatory, and a long-standing local reputation for tall tales. Ruppelt's team ultimately closed the case as “the best hoax in UFO history,” while disclosing that two pieces of physical evidence — charred grass roots and spark-pattern burn holes in his cap — were never mechanistically explained.
BR
Age 12 in 1952
Boy Scout, Secondary Witness
One of three Boy Scouts in the car during the Sonny DesVergers Scoutmaster Case, watching scoutmaster Sonny DesVergers's flashlight beam in the palmetto thicket before seeing a red glow appear to engulf him. A later night-time reenactment found the boys' claimed sightline into the clearing could not actually be achieved even standing on the car roof.
DR
Age 11 in 1952
Boy Scout, Secondary Witness
A second of the three Boy Scouts present during the Sonny DesVergers Scoutmaster Case, whose corroboration was limited to distant lights and a red flash rather than a direct view of any craft.
CS
Boy Scout, Secondary Witness
The youngest of the three Boy Scouts present during the Sonny DesVergers Scoutmaster Case, and the member of the group most often quoted in later retrospective accounts of the incident.
Palm Beach County Sheriff's Office; First Law Enforcement on Scene
Among the first responders to the farmhouse alarm raised in the Sonny DesVergers Scoutmaster Case; found Sonny DesVergers coming out of the ditch beside the road and remarked he had never seen a man so frightened in all his years in law enforcement. His call to the Air Force set the Project Blue Book investigation in motion.
AH
Active 1970–1972
Forestry Worker, Imjärvi, Finland; Primary Witness
With Esko Viljo, encountered a disc-shaped craft and a small humanoid figure near Imjärvi on January 7, 1970, in the Imjärvi Incident, suffering months of unexplained physical illness afterward. Went on to report more than twenty further UFO sightings over the following two years, escalating by 1972 into a sustained series of contact claims involving a humanoid "spacewoman" — a trajectory later assessed by Swedish ufologist Anders Liljegren as resembling folklore more than credible testimony.
EV
Active 1970
Farmer, Imjärvi, Finland; Primary Witness
With Aarno Heinonen, independently corroborated the disc and humanoid sighting at the center of the Imjärvi Incident on January 7, 1970, while facing the phenomenon directly himself. Suffered facial swelling, reddening, and joint pain afterward, with a comparatively faster recovery than Heinonen's, and was less associated with Heinonen's later escalating contact claims.
MH
Active 1970
Neighbor and Local Municipal Council Member, Imjärvi, Finland
Reported in secondary sources to have vouched publicly for Aarno Heinonen and Esko Viljo's sober, sensible character in the immediate aftermath of the Imjärvi Incident.
CB
Active 1950
Business Manager, Farmington Times; Former U.S. Army Engineers Captain
A 32-year-old former U.S. Army Engineers captain who had served in Italy during World War II, Boddy was on a Farmington roadway on the morning of March 17, 1950 when he saw a few moving objects high in the sky that grew, within moments, to what he estimated as roughly 500 silvery discs at approximately 15,000 feet. His account, printed under his own name in the Farmington Daily Times' front-page report the next day, was corroborated on the record by four additional named residents.
JE
Active 1950
Real Estate & Insurance Salesman; Reported Former U.S. Navy Pilot
A 29-year-old Farmington real estate and insurance salesman, Eaton was one of the first two witnesses (with garage employee Edward Brooks) to report the sighting's distinctive red-colored "leader" object, which he described as "definitely red" and traveling "northeast at a terrific speed." A later research pass by physicist James E. McDonald, reflected in NICAP's own case summary, separately identifies Eaton as a former Navy pilot who put the objects' height at roughly 15,000 feet and described smaller objects that would "turn and appear to be flat, then turn and appear to be round."
HT
Head, Farmington Unit, U.S. Soil Conservation Service
Thatcher performed a rough triangulation on one of the objects, reasoning that if it were the size of a B-29 bomber it would have been at roughly 2,000 feet and traveling faster than 1,000 mph — a size-referenced estimate, not a direct measurement, that he defended on the strength of engineers working under him. He separately and emphatically rejected State Patrolman Andy Andrews' contemporaneous "cotton fuzz" theory, telling the Farmington Daily Times: "It was not cotton. I saw several pieces of cotton fuzz floating around in the air at the time, but I was not sighting on any cotton."
MW
Active 1950; re-interviewed 2014–15
Garage Employee, Perry Smoak Garage, Farmington; Later Farmington Mayor
A Perry Smoak garage employee in 1950, Webb described the objects to the Farmington Daily Times as appearing roughly eight inches in diameter from the ground, "about the size of a dinner plate," flying "sideways, on edge and at every conceivable angle." Sixty-four years later, researcher David Marler tracked Webb down as a then-nonagenarian, WWII veteran, former Farmington mayor, bank president, and private pilot who still affirmed having seen an unidentified formation from the garage window on March 16, 1950, the flap's first day. Modern secondary accounts render his first name "Marlo"; this file preserves the original 1950 clipping's own spelling.
EB
Active 1950
Employee, Perry Smoak Garage, Farmington; WWII B-29 Tail Gunner
A 24-year-old garage employee and wartime B-29 Superfortress tail gunner, Brooks was, with Johnny Eaton, one of the first two to report the sighting's red-colored object. Drawing directly on his own combat-aircrew experience, he told the Farmington Daily Times: "The very maneuvering of the things couldn't be that of modern aircraft."
AA
Active 1950
New Mexico State Patrolman
Originated a same-week, purely local "cotton fuzz" theory, quoting several Farmington residents as asserting the objects were floating cotton — a theory those same residents then denied to the Farmington Daily Times, and one Harold F. Thatcher personally and specifically rejected. Andrews' theory predates, and is entirely independent of, Donald Menzel's later Skyhook-balloon explanation.
Meteorological Officer, Argentine Navy Detachment, Deception Island
Sole witness to the opening two sightings of the Deception Island Sightings, on the nights of June 7 and June 8, 1965: both brief, stationary-light observations made during his own routine meteorological duty at the Argentine Navy's First of May Bay post.
Argentine Navy Detachment, Deception Island
The garrison member who, while on duty at the base's meteorological observatory, first spotted the object during the central, 62-minute July 3, 1965 sighting at the heart of the Deception Island Sightings — the observation that 16 further Argentine and Chilean personnel would go on to share.
Meteorologist, Argentine Navy Detachment, Laurie Island
One of two meteorologists who, at 17:03 on July 3, 1965, observed a round bluish-white object cross the sky on a parabolic path at the Argentine base on Laurie Island — the Deception Island Sightings' one sighting associated with a tape-recorded instrumented anomaly, when two on-site variometers reportedly registered a sudden magnetic-field disturbance at the same moment.
Meteorologist, Argentine Navy Detachment, Laurie Island
Co-witness, alongside José Jarriek, to the July 3, 1965 Laurie Island sighting described in the Deception Island Sightings file, at the exact hour two on-site variometers reportedly recorded a sudden magnetic-field disturbance on tape.
Argentine Navy Detachment, Deception Island
Credited in the Chilean Air Force's official communiqué with taking ten color photographs of the object during the July 3, 1965 sighting described in the Deception Island Sightings file — the case's only claimed photographic evidence, though no image from that roll is known to have ever been published or independently examined.
C
fl. 1954
Airport Fireman, Marseille–Marignane Airport
The sole primary witness to the Marignane Airport Landing of January 4, 1954: an on-duty fireman posted at the airfield's Boussiron hangar who watched a silvery, self-luminous discoidal object descend, touch down, bounce, and come to rest on the runway before it vanished as he telephoned the control tower. No source consulted preserves his first name, and a planned follow-up interview with journalist Constant Vautravers a month later never took place after Chesneau was reassigned elsewhere before the appointment.
GG
Customs Officer, Marseille–Marignane Airport
A customs officer on night duty at Marignane Airport who reported, on October 27, 1952 — roughly fourteen months before the airport's better-documented January 1954 landing — a small, dark, cigar-shaped object with four flickering lit windows that touched down briefly on the tarmac around 100 meters from him before departing within two seconds amid sparks and a rocket-like noise. He provided a written statement with sketches to investigators on October 31, 1952, published in the Commission Ouranos's bulletin in January 1953, treated on this site as the historical precedent to the Marignane Airport Landing case.
LG
Spanish Navy
Four crew members of the Spanish Navy's flagship training vessel — the officer of the watch, two midshipmen, and a boatswain's mate — independently logged a precisely timed, geometrically described semicircular halo while under way west of Lanzarote, providing some of the most detailed and internally consistent testimony in either sighting.
LZ
Active 1964
Police Officer, Socorro Police Department
The primary witness of the April 24, 1964 landing. Zamora observed the craft at close range, witnessed the two small figures in coveralls, and watched the takeoff and departure. His spotless record, literal-mindedness, and consistent testimony convinced investigators from the FBI, Army, and Project Blue Book of his absolute honesty. Despite intense media pressure and personal stress, Zamora never changed his account. He resigned from the police force several years later and worked at a service station, passing away in 2009. His testimony remains the anchor of the Socorro case, representing one of the most reliable and highly scrutinized witness accounts in the history of UAP research.
MM
Active 1979
Airport Director and ~40 Ground Personnel, Manises Airport
Reported observing as many as three additional unidentified radar and visual contacts near the airfield as flight JK-297 landed, with one object approaching closely enough to prompt activation of the runway's emergency lighting system. This ground-level corroboration, independent of both the flight crew and the intercepting fighter pilot, is a structurally important third leg of the case's witness base.
Royal Canadian Mounted Police, Barrington Passage Detachment
Werbicki, the detachment commander, directed the RCMP's rapid response, while O'Brien contacted the Rescue Coordination Centre and obtained the critical, immediate confirmation that no aircraft anywhere on the eastern seaboard was missing or overdue — a negative finding that shaped the entire subsequent investigation.
🚀

Astronauts

6
EM
1930 – 2016
Apollo 14 Lunar Module Pilot; 6th person on the Moon
Founded the Institute of Noetic Sciences (IONS) in 1973 after a consciousness-expanding experience on his return from the Moon. Became one of the most prominent advocates for UAP disclosure, claiming he was "privileged enough to be in on the fact" that ET visitation is real. Stated officials confirmed to him the Roswell crash was genuine. Claimed ETs are interested in preventing nuclear conflict.
IONS Roswell Nuclear-UAP Consciousness
GC
1927 – 2004
Mercury Seven & Gemini astronaut
Reported witnessing a disc-shaped craft land and take off at Edwards AFB in 1957; the event was filmed but the film was confiscated and sent to Washington. In 1978, wrote a letter to the United Nations advocating for scientific UFO study, stating "extraterrestrial vehicles and their crews are visiting this planet." One of the most credible witnesses in history based on his credentials.
Edwards AFB United Nations Mercury Program
NA
1930 – 2012
Commander, Apollo 11; Naval aviator, X-15 test pilot, Gemini 8 command pilot
A Navy fighter pilot who flew 78 combat missions over Korea before becoming a civilian research test pilot on the rocket-powered X-15, then commanded Gemini 8's first-ever docking in space. As commander of Apollo 11, Armstrong took part in the crew's July 1969 in-flight examination of an unidentified object near the spacecraft, telling the July 31, 1969 Technical Crew Debriefing it was "right at the limit of the resolution of the eye" and impossible to size or range with confidence — testimony that has since been mined selectively by UFO literature while the crew's own real-time, multi-candidate mundane analysis is generally omitted.
Lunar Module Pilot, Apollo 11; USAF fighter pilot, MIT-trained astronautics engineer
An Air Force fighter pilot with 66 combat missions in Korea and a doctorate in astronautics from MIT, Aldrin was the crewmember most vocal about Apollo 11's in-flight sightings, describing an unidentified "sizeable" object examined with a monocular and sextant during translunar coast, a separate series of unexplained light flashes inside the darkened cabin (since attributed to cosmic-ray interaction with the retina), and a bright light near Earth on the return leg he initially and only briefly speculated could be a laser before the crew concluded it was sunlight reflecting off a lake. In a 2005 Science Channel interview he stated he remained "absolutely convinced" the translunar object was sunlight reflecting off one of the spacecraft's own jettisoned panels.
MC
1930 – 2021
Command Module Pilot, Apollo 11; USAF fighter pilot and test pilot
An Air Force fighter pilot and experimental test pilot who flew Gemini 10 before piloting Command Module Columbia on Apollo 11, remaining alone in lunar orbit during the Moon landing. During translunar coast, Collins used the CM's sextant to try to resolve the unidentified object his crewmates had spotted, later telling the Technical Crew Debriefing that an out-of-focus view through the instrument made it briefly appear as "a hollow cylinder" or "two connected rings" before a focus change revealed the same light as an "open-book" shape — a detailed, instrument-documented account of exactly the kind of optical artifact that produced the case's enduring "cylindrical UFO" label.
PP
1930 – 2009
Soviet Cosmonaut; President, All-Union Ufological Association
The fourth Soviet cosmonaut to fly in space (Vostok 4, 1962) and later commander of Soyuz 14, Popovich headed the All-Union Ufological Association and, on October 24, 1991, personally received the KGB's declassified 124-page "Blue Folder" of anomalous-phenomena case files — including the Kapustin Yar UAP Sighting — from outgoing KGB deputy chairman N.A. Sham. Popovich later passed custody of the Blue Folder to Vladimir Azhazha.
📜

Historical Figures

37
NT
1856 – 1943
Inventor, electrical engineer; pioneer of AC power systems
In 1899, while experimenting in Colorado Springs, claimed to receive structured electrical signals he believed were extraterrestrial communications from Mars. His pioneering work on electromagnetic fields, wireless energy transmission, and directed energy underpins many theoretical UAP propulsion frameworks. His papers were seized by the FBI after his death — fueling theories connecting them to later classified aerospace developments.
Electromagnetic Research FBI Advanced Propulsion
TB
1905 – 1985
Physicist; electrogravitics pioneer
Discovered the "Biefeld-Brown effect" — apparent thrust from high-voltage asymmetric capacitors — which he interpreted as a link between electricity and gravity. His 1952 Project Winterhaven proposal and 1955–56 aerospace-industry demonstrations were formally evaluated and rejected by the U.S. Navy's Office of Naval Research, whose physicist Willoughby Cady and, decades later, Martin Tajmar's peer-reviewed vacuum tests found the effect is ordinary ion-wind (corona-discharge) thrust, not antigravity. Co-founded NICAP in October 1956, one of the first major civilian UFO organizations, though he was removed as director within about ten weeks. His name was later, and falsely, associated with the debunked "Philadelphia Experiment" legend by a 1979 book published decades after his real Navy service had ended. Full case file: T. Townsend Brown & Electrogravitics.
NICAP Electrogravitics U.S. Navy Donald Keyhoe Project Winterhaven Case File #192
WB
1912 – 1977
Rocket scientist; architect of Saturn V; NASA director
Brought to the U.S. via Operation Paperclip. His assistant Carol Rosin claims that on his deathbed, von Braun warned about a sequence of fabricated threats the military-industrial complex would use to justify space weapons — ending with a staged alien invasion. This "deathbed warning" is frequently cited in disclosure circles, though it rests solely on Rosin's uncorroborated testimony.
Operation Paperclip NASA Allen Dulles Carol Rosin
TI
Reigned 1479 – 1425 BCE
Sixth Pharaoh, Eighteenth Dynasty of Egypt
One of ancient Egypt's most militarily successful rulers, called "the Napoleon of Egypt" for roughly seventeen victorious campaigns. His reign is the alleged setting of the disputed Tulli Papyrus "fiery discs" story — but no aerial anomaly of the kind later claimed appears anywhere in his own extensively documented contemporary Karnak annals or any other securely dated text from his reign.
Hatshepsut Tulli Papyrus
Pharaoh & Co-Regent, Eighteenth Dynasty of Egypt
Powerful stepmother and co-regent of Thutmose III for the first twenty-two years of his reign before his sole rule began in 1458 BCE. Mentioned in discussions of the disputed Tulli Papyrus only as context for dating the reign the fabricated "fiery discs" story claims to describe.
AT
Director, Egyptian Section, Vatican Museums (1931–1942)
A real, historically documented Vatican Egyptologist who is the originating figure of the disputed Tulli Papyrus. He never published the alleged text in his lifetime, never purchased the physical object, and left only a rushed handwritten transcription made, by his own account, during a single brief viewing at a Cairo antiquities shop in 1933–34. His own eventual successor, Gianfranco Nolli, considered him at best an amateur in the relevant philological specialty and suspected he had been deceived by the dealer.
Gianfranco Nolli Tulli Papyrus
HG
c. 1500 – 1573
Nuremberg Brieffmaler, Woodcutter & Publisher
Documented in Nuremberg's own trade records from 1538, Glaser published the illustrated broadsheet describing the April 14, 1561 "celestial battle" over Nuremberg — the sole surviving source for the entire case. He is not established as a personal eyewitness, and had an existing commercial specialty in "miracle sign" broadsheets, having already published two similar sheets in 1554.
JW
1522 – 1588
Zurich Minister & Archivist; Compiler of the Wickiana
A Reformed minister at Zurich's Grossmünster church who spent nearly three decades (1559–1588) systematically collecting broadsheets and letters documenting "wondrous and horrifying" events across German-speaking Europe into the 24-volume Wickiana archive. Without his archival instinct, neither the Hans Glaser broadsheet describing the 1561 Nuremberg celestial phenomenon nor the Coccius/Apiarius broadsheet describing the 1566 Basel celestial phenomenon would very likely survive in any known copy today.
SC
1548 – 1626
Basel Scripture Scholar & Art Student; Compiler of the 1566 Basel Broadsheet
A Basel-born scripture scholar and art/liberal-arts student, roughly eighteen years old in 1566, who compiled the written account of the July 27 – August 7, 1566 celestial phenomenon over Basel from testimony gathered "from first and second hand" rather than personal witness. Later biographical sources record him as a Basel theologian (name-variants Koch, Köchlin, Essig) who lived until 1626; the Basel broadsheet is his sole known surviving literary work. He framed the sighting explicitly as a religious portent tied to the Swiss Confederacy's fear of Ottoman invasion.
SA
d. April 12, 1590
Printer & Publisher, Bern / Solothurn / Basel
A print-trade professional expelled from Bernese printing privileges in 1559 over a private dispute and again in 1564 specifically for printing defamatory songs, after which he founded the first print shop in Solothurn before relocating to Basel in 1566 — the same year he printed the broadsheet describing the celestial phenomenon over that city, compiled from Samuel Coccius's testimony. In Basel he went on to produce numerous "Neue Zeitungen" news broadsheets, folk songs, calendars, and official civic mandates through 1589, one year before his death.
MK
fl. 1940s
Photo-Discoverer, Hopeh Province Sighting (Not an Eyewitness)
A Japanese man (surname also romanized "Kiryu") who, according to the only account of the case's origin, found a single street photograph of a dark, conical/hat-like object over a Tientsin (Tianjin) street while going through his father's photo album. He is not a witness to the object itself in any version of the story — every account agrees he discovered an already-existing print, years or decades after whatever event it depicts, and learned from his father that it had been purchased from a Tientsin street photographer as a souvenir. No birth date, death date, or biographical detail beyond this single anecdote has been established for him, and the photograph's own date is itself disputed between 1911 and 1942.
SS
Sanskrit Scholar, Mysore; Source of the Vaimanika Shastra
A Mysore-based Sanskrit pandit who reportedly dictated the roughly 3,000 verses of the Vaimanika Shastra between 1918 and 1923, claiming psychic transmission from the sage Bharadvaja. Had no formal training in aeronautics, physics, or engineering. Died in 1940, twelve years before publisher G.R. Josyer first revealed the text's existence; a 1974 Indian Institute of Science analysis later concluded the text could not have been composed earlier than approximately 1900–1904.
Vaimanika Shastra Vimana / Vedic Aerial Chariots
ER
1890 – 1973
Medal of Honor WWI Flying Ace; President, Eastern Air Lines (1938–1959)
America's top-scoring WWI flying ace before becoming an aviation industry pioneer and longtime president of Eastern Air Lines. Personally verified Project Sign investigator Alfred Loedding's Air Force credentials before authorizing Eastern's pilots — including Capts. Clarence Chiles and John Whitted after their July 1948 sighting — to route future in-flight UFO reports directly to military intelligence rather than the press first.
DB
1924 – 2018
Crop-Circle Hoaxer, Wiltshire, England
Beginning in 1978, Bower and fellow prankster Dave Chorley used a plank, rope, and a wire-loop cap sight to flatten circular patterns into English cereal fields, sparking the "cereology" phenomenon that spread across the UK, Europe, the U.S., and Japan through the 1980s. When the pair confessed publicly in 1991, they specifically credited newspaper coverage of the 1966 Tully, Queensland "saucer nests" — which Bower had read before emigrating from Australia — as their original inspiration, making the Tully case the acknowledged historical point of origin for the modern crop-circle phenomenon.
CD
Retired butcher & outsider artist; sole narrator of the Sonora Aero Club
A Prussian-born Houston butcher and later saddlery clerk who, after retiring around 1899–1900 in his late sixties, spent more than two decades producing at least twelve hand-bound notebooks of roughly 2,500 ink, watercolor, and newspaper-collage drawings. The notebooks narrate his claimed youth as the official draftsman of a secret 1850s Sonora and Columbia, California airship society, the Sonora Aero Club, powered by a fictional anti-gravity fuel he called "NB Gas." No independent 1850s record of the club, or of Dellschau's presence in California during the claimed period, has ever been found; a documented 1856 Texas record places him outside the state entirely. Discovered in a Houston junk shop more than 40 years after his death, his notebooks are now held by the Menil Collection, the American Folk Art Museum, the Witte Museum, and the San Antonio Museum of Art. Full case file: Sonora Aero Club Secret Society.
PM
d. 1860s (claimed)
Claimed Sonora Aero Club leader & inventor of "NB Gas" (per Dellschau's narrative only)
The central figure of Charles Dellschau's Sonora Aero Club notebooks — depicted as a rough, pipe-smoking miner who discovered the club's signature anti-gravity fuel and piloted its first craft, the Aero Goose, before his death allegedly ended the club and took the fuel's formula to the grave. A real Peter Mennis has been traced in period records, but that individual fought in the 1846–48 Mexican-American War and died in 1901 — a biography that does not match Dellschau's Gold Rush character. Whether Dellschau borrowed a real name for an invented figure, misremembered details, or is describing someone else entirely is unresolved. No independent, contemporaneous 1850s record of a "Peter Mennis" matching Dellschau's Sonora Aero Club narrative has been found.
SH
Active 1897
Aurora Correspondent, Dallas Morning News — Sole Source of the 1897 Airship Story
A cotton buyer and part-time local correspondent whose April 19, 1897 article is the entire evidentiary basis for the Aurora UFO Crash legend — a claimed airship collision with Judge J.S. Proctor's windmill and the burial of a "not of this world" pilot. No second 1897 source ever corroborated any detail of his account. Longtime Aurora historian Etta Pegues later said Haydon "wrote it as a joke and to bring interest to Aurora," and described him as having "a well-known reputation for telling tall tales."
JP
Property Owner, Aurora, Texas — Site of the Claimed 1897 Airship Crash
Named in S.E. Haydon's 1897 article as the owner of the windmill and flower garden the alleged airship destroyed. Left no known first-person account of the incident. Aurora historian Etta Pegues stated in 1979 that "the judge never even had a windmill," a claim later complicated, though not resolved, by the discovery of an apparent windmill base on the property during a 2008 site investigation. Some retrospective accounts have speculated Proctor may have helped encourage the story alongside Haydon, though this is unproven.
TW
1842 – 1925
Aurora Blacksmith — Misrepresented in 1897 as a Signal Service "Astronomer"
A Confederate Army veteran (Wells' Regiment, Texas Cavalry, Company B) and, by 1897, Aurora's working blacksmith. S.E. Haydon's article identified him as "the United States signal service officer at this place and an authority on astronomy" who concluded the alleged crashed pilot "was a native of the planet Mars." No record of any Signal Service post at Aurora or of Weems holding any military or scientific credential has ever been found; the apparent fabrication of his expert authority is among the strongest single pieces of evidence that the Aurora UFO Crash story was constructed rather than reported.
EP
d. 86, interviewed 1979
Longtime Aurora, Texas Historian — Source of the Central Hoax Testimony
A lifelong Aurora resident whose widely syndicated 1979 interview, later repeated nationally by Time magazine, produced the case's single most consequential piece of skeptical testimony: "Hayden wrote it as a joke and to bring interest to Aurora. The railroad bypassed us, and the town was dying," and "the judge never even had a windmill." Not old enough in 1897 to have personally witnessed the story's origin as an adult, her account is oral tradition rather than a direct confession from Haydon himself, but it remains the most-cited single source on either side of the Aurora UFO Crash debate.
BO
Owned property c. 1935–1970s
Property Owner, Former Proctor Farm, Aurora, Texas — Sealed the Well
Purchased the former Judge J.S. Proctor property in the mid-1930s. According to accounts relayed by his family, Oates developed severe arthritis he attributed to drinking water from the property's well, which he believed contained dissolved wreckage debris, and had the well sealed with a concrete slab. His decision left the well undisturbed until a 2008 site investigation. No causal medical link between well water and arthritis at the levels later measured has ever been established. Full case file: Aurora UFO Crash.
GC
San Francisco Patent Attorney — Claimed to Represent the 1896 Airship's "Inventor"
In late November 1896, days after the Sacramento airship sightings drew national press attention, Collins told reporters he represented a wealthy, secretive inventor conducting covert nighttime test flights of a working 150-foot airship, later naming the inventor as dentist Dr. E.H. Benjamin. Within days he reversed himself entirely: "I never saw the airship and don't know anything about it." No patent, prototype, or independent record of the claimed airship has ever surfaced; historians treat the episode as one of the wave's earliest and clearest manufactured hoaxes. Full case file: The Great Airship Wave of 1896-1897.
EB
b. c. 1862, aged 34 in 1896
San Francisco Dentist — Named as the 1896 Airship's Secret Inventor
A 34-year-old San Francisco dentist publicly identified by attorney George D. Collins as the wealthy secret inventor behind the November 1896 Sacramento airship sightings, said to have spent fifteen years developing flying-machine designs. No independent record has ever placed Benjamin as an inventor of any kind, and no airship, patent, or prototype connected to him has ever been located; his supposed role evaporated the moment Collins's claim collapsed within days. Full case file: The Great Airship Wave of 1896-1897.
AH
1832 – 1912
Rancher, Everett Township, Woodson County, Kansas — Source of the Confirmed 1897 "Cattle Lasso" Hoax
Reported on April 19, 1897 that he, his son, and a hired hand watched a 300-foot cigar-shaped airship lasso one of his heifers with a red cable and carry it off into the night; produced a notarized affidavit, signed by eleven local officials including the sheriff and a physician, attesting to his character. In 1976, an elderly Kansas woman came forward stating she had personally heard Hamilton privately admit the story was invented to win a local "liars' club" tall-tale contest; UFO historian Jerome Clark's 1977 investigation corroborated the account, making this the wave's most thoroughly documented confirmed hoax — though the debunking itself rests on secondhand, decades-later testimony rather than a signed confession. Full case file: The Great Airship Wave of 1896-1897.
JL
14th Governor of Kansas — Among Hundreds of Witnesses to the March 28, 1897 Topeka Sighting
A Populist inaugurated as Kansas's governor on January 11, 1897, Leedy was reportedly among several hundred Topeka residents who watched a slow-moving "blood red light" cross the night sky on March 28, 1897, a sighting significant enough to reach the pages of Denver's Rocky Mountain News. With no known economic or promotional motive to embellish or invent a sighting, his reported presence is treated by researchers as one of the wave's stronger individual credibility signals, distinct from Kansas's own contemporaneous Alexander Hamilton hoax. Full case file: The Great Airship Wave of 1896-1897.
RH
Farmer, near Sioux City, Iowa — Early Named Witness of the Wave's Second Phase
A farmer living roughly fifteen miles north of Sioux City, Iowa who, in March 1897, reported an unusually configured light in the sky as the wave's second, Midwestern phase reached Iowa — among the earliest individually named witnesses of the much larger sighting burst that would sweep Nebraska, Kansas, Illinois, and Texas over the following weeks. Full case file: The Great Airship Wave of 1896-1897.
Founder, Taizé Community, Saône-et-Loire, France
A Swiss-born Reformed pastor who founded the ecumenical Christian monastic Taizé Community in 1940, initially sheltering refugees during the Second World War before building an internationally known pilgrimage site drawing thousands of young visitors annually for communal prayer. Mentioned here only as background context: the August 1972 Taizé Landing Case occurred among young pilgrims attending one of the community's regular summer gatherings his project established; he is not himself a witness to that case.
NR
1874 – 1947
Painter, archaeologist, explorer; leader, Roerich Central Asian Expedition
Russian-born painter and stage designer (Diaghilev's Ballets Russes, Stravinsky's The Rite of Spring, 1913) who turned to Theosophy and Central Asian exploration in the 1920s. With his wife Helena Roerich he co-developed the Agni Yoga teaching and led the Roerich Central Asian Expedition (1924–1928) in search of the legendary kingdom of Shambhala. On August 5, 1927, Roerich and members of his expedition observed a large, shining, oval object over their camp near the Humboldt Mountains, recording the event in two of his own books, Altai-Himalaya (1929) and Heart of Asia (1930). He later authored the 1935 Roerich Pact protecting cultural heritage during wartime.
HR
1879 – 1955
Philosopher; co-founder of Agni Yoga; expedition member
Wife of Nicholas Roerich and co-author, with him, of the Agni Yoga ("Living Ethics") teachings the couple began developing in London in 1920. She accompanied her husband and son on the Roerich Central Asian Expedition (1924–1928), including the August 5, 1927 camp near the Humboldt Mountains where the expedition observed the shining oval object at the center of the Roerich Expedition Sighting case file.
GR
Orientalist, linguist; expedition interpreter and security officer
Eldest son of Nicholas and Helena Roerich, a Harvard- and Sorbonne-trained Tibetologist and linguist fluent in Tibetan, Mongolian, and several Central Asian dialects. He served as the Roerich Central Asian Expedition's interpreter and de facto security chief, and later authored Trails to Inmost Asia (1931), the expedition's own scientific account. He was present in camp during the August 5, 1927 sighting near the Humboldt Mountains.
SH
1865 – 1952
Swedish explorer, geographer
Renowned Swedish explorer of Central Asia who led the Sino-Swedish Expedition (1927–1935), a large scientific survey of Mongolia, the Gobi Desert, and Xinjiang that included a meteorological pilot-balloon program. Hedin's expedition, active in the same broad region and year as the Roerich party's 1927 sighting, is the basis of the leading conventional explanation proposed for the Roerich Expedition Sighting case.
AT
1906 – 2001
Author; early popularizer of the Roerich sighting in ufology
Russian-born, multilingual Australian author who attended one of Nicholas Roerich's own lectures in Shanghai in the 1930s and later became the primary conduit carrying Roerich's 1927 sighting account into wider ufological literature, including in his own 1977 book Shambhala: Oasis of Light.
KG
Translator; First Complete English Mahabharata (1883–1896)
Bengali scholar who produced the first — and still the only complete public-domain — English prose translation of the entire Mahabharata, issued in parts over thirteen years as The Mahabharata of Krishna-Dwaipayana Vyasa Translated into English Prose. He initially wanted to publish anonymously; his publisher and financier Pratap Chandra Roy objected, and the resulting compromise led to years of confusion in which Roy was widely mistaken for the translator. Virtually every English-language "ancient nuclear war" quotation drawn from the epic ultimately derives from Ganguli's text, almost always at two or more removes, through writers who did not know, or credit, whose translation they were altering.
KB
1767 – 1848
Edo-period Novelist & Compiler; Recorded the Fullest Surviving Utsuro-bune Account in Toen shōsetsu (1825)
Also known as Takizawa Bakin, one of the most productive and commercially successful authors in Japanese literary history, best remembered for the epic Nansō Satomi Hakkenden. His 1825 compilation Toen shōsetsu was assembled for the Tōenkai, a society of Edo literati who met to exchange strange and noteworthy reports, and his version of the utsuro-bune account is the fullest and most influential — effectively every modern retelling of the legend descends from it. Bakin did not treat the story as inexplicable: he immediately compared the woman's described appearance against a published account of Russian dress and proposed she might be Russian, British, or American.
KY
1875 – 1962
Founder of Japanese Folklore Studies (minzokugaku); First Academic Analyst of the Utsuro-bune Tradition
The founding figure of Japanese folklore studies as an academic discipline, whose Tōno monogatari (1910) and decades of subsequent fieldwork established the field's methods. Yanagita examined the utsuro-bune material in 1925 and returned to it in 1962, near the end of his life, concluding the 1803 account was a fabrication grown from authentic traditional roots: round boats were ordinary working vessels in Japan, and the story's exoticism lay entirely in its added Western-coded details — glass windows, metal plating, a red-haired occupant. He connected the underlying motif to the wider Japanese tradition of visitors arriving from across the sea.
PA
Drug Trafficker, “El Zorro de Ojinaga” (“The Fox of Ojinaga”)
A Mexican narcotics trafficker who controlled the Ojinaga–Presidio border smuggling corridor in Chihuahua from the 1970s until his 1987 death in a Mexican federal police raid, moving marijuana and heroin north from the early 1970s and later flying Colombian cocaine into remote desert airstrips by light aircraft. His documented career establishes that the exact stretch of Chihuahuan desert surrounding Coyame was a real, active narcotics-aircraft corridor throughout the same decade the Coyame UFO crash claim alleges its unwitnessed collision occurred, a documented regional history this site's research treats as directly relevant to that case's leading conventional explanation candidate.
DH
Swedish historian
A Swedish academic historian who, assessing the Ängelholm case from outside the UFO research community, characterized Gösta Carlsson's account simply as "alleged but not proven" — a widely quoted, deliberately measured verdict that neither endorses nor definitively debunks the claim.
💼

Private Sector

139
AB
Industrialist; Private Patron, Whitehall Rand Project
Wealthy North Carolina industrialist who personally funded T. Townsend Brown's most sustained period of independent electrogravitics research from November 1957 until his own death in 1964, through the privately organized Whitehall Rand Project in Winston-Salem. His death effectively ended the last serious attempt to further develop Brown's electrokinetic devices.
RB
Billionaire; founder, Bigelow Aerospace
Purchased Skinwalker Ranch in 1996 for UAP/paranormal research through NIDS. His company BAASS received the $22 million AAWSAP contract from the DIA. Told 60 Minutes in 2017 he is "absolutely convinced" of an ET presence on Earth. Has spent more personal wealth on UFO research than any other private individual. Connected to Knapp, Puthoff, Elizondo, and Lacatski.
AAWSAP Skinwalker Ranch George Knapp Hal Puthoff
BR
1925 – 1995
Second Director of Lockheed Skunk Works (succeeded Kelly Johnson)
Led the development of the F-117 Nighthawk stealth fighter. Before his death in 1995, he reportedly made several famous remarks regarding classified aerospace capabilities, stating: "We already have the means to travel among the stars, but these technologies are locked up in black projects... and it would take an act of God to ever get them out." and "We now have the technology to take ET home." Represented the peak of compartmented aerospace engineering.
Skunk Works Stealth Tech Kelly Johnson Black Budgets
JP
1914 – 1952
Co-founder of JPL; rocket scientist & occultist
Pioneer of solid rocket fuel and co-founder of the Jet Propulsion Laboratory. Devoted follower of Aleister Crowley who conducted the "Babalon Working" with L. Ron Hubbard in 1946 — some theorists speculate this "opened a portal" coinciding with the 1947 UFO wave. Represents the intersection of cutting-edge aerospace science and esoteric practices. Died in a mysterious laboratory explosion at age 37.
JPL Aleister Crowley L. Ron Hubbard 1947 Wave
Comic Artist & Illustrator, Poland
Illustrated Przybysze ("The Visitors"), a 1978 Polish comic book dramatizing Jan Wolski's Emilcin encounter, one of the earliest popular-culture treatments of the case and a marker of how quickly it entered wider Polish public awareness.
CP
Active 1952
Fighter Pilot, Elisabethville Airfield, Belgian Congo
A Belgian colonial fighter pilot identified in a declassified CIA intelligence report only by rank and first name, Pierre pursued two fiery, discus-shaped objects over the Katanga uranium-mining district near Shinkolobwe for roughly fifteen minutes in early 1952, closing to an estimated 120 meters of one before both objects departed toward Lake Tanganyika. Described by the CIA's own translated report as "a dependable officer and a zealous flyer," he remains the sole named witness in the Flying Saucers Over the Belgian Congo Uranium Mines case; no surname or independent Belgian service record has been located.
Radar Operator, Long Range Weapons Establishment, Woomera
The radar operator who authored the detailed written report on the October 8, 1952 Woomera radar contact — an unidentified, radar-invisible-to-telescope target tracked for roughly 24–44 minutes at heights between 1,500 and 5,600 feet, discussed in this site's Woomera Rocket Range Sighting case as historical context for the better-documented 1954 case. Millard's own report, after investigation, attributed the return to a snow cloud, and a security officer's contemporaneous comment on the same file additionally floated the possibility of a "neutron cloud" — neither explanation independently confirmed in any surviving document this case file's research could locate.
GK
fl. 1954
Range Personnel, Woomera (rank and surname only on record)
Identified in secondary summaries of the National Archives of Australia's D174 case file only by rank and surname, Keane is named as a co-observer of the radar-and-visual sighting of May 5, 1954 at Woomera, the centerpiece of this site's Woomera Rocket Range Sighting case. No first name, unit, or further service record has been located in any source consulted for this case file.
CV
Served 2000–2006
Secretary of National Defense (SEDENA), Mexico, 2000–2006
As head of Mexico's Secretariat of National Defense under President Vicente Fox, Vega García authorized the unprecedented public confirmation of the March 5, 2004 Campeche FLIR sighting, personally briefing ufologist Jaime Maussan on the case on April 20, 2004 and authorizing him two days later to receive copies of the sensor recordings and publicize them without censorship. When later pressed on why SEDENA gave the material to a television personality rather than commissioning an independent scientific study, Vega García said only that it was "perhaps because we do not know [scientists] or know who they might be," adding that the data remained open to any interested researcher. Discussed in this site's Campeche Military FLIR Incident case file.
Aircraft Commander, Mexican Air Force 501st Air Squadron
Piloted and commanded the Merlin C-26A twin-engine turboprop during the March 5, 2004 anti-narcotics radar patrol over Ciudad del Carmen, Campeche, when radar operator Lt. Germán Marín Ramírez and FLIR operator Lt. Mario Adrián Vázquez Téllez registered a cluster of unidentified infrared and radar returns near the aircraft. Told journalists afterward, "I believe they could feel we were pursuing them," noting the returns disappeared once the crew broke off. The subject of this site's Campeche Military FLIR Incident case file.
Radar Operator, Mexican Air Force 501st Air Squadron
Operated the AN/APS-143(V)3 surveillance radar aboard the Merlin C-26A during the March 5, 2004 Campeche patrol, calling out a fluctuating count of intermittent contacts — at one point audibly counting as many as eight on the tape — while the aircraft's FLIR turret separately recorded eleven infrared returns. Told reporters at SEDENA's May 2004 press conference, "Was I afraid? Yes. A little afraid because we were facing something that had never happened before." The subject of this site's Campeche Military FLIR Incident case file, which discusses in detail the mismatch between his radar counts and the FLIR operator's separate count.
FLIR (Infrared Sensor) Operator, Mexican Air Force 501st Air Squadron
Operated the aircraft's FLIR Star SAFIRE II infrared turret during the March 5, 2004 Campeche patrol, recording eleven bright, round infrared returns despite no corresponding contact being visible to the naked eye. Told reporters, "I couldn't say what it was ... but I think they're completely real." The subject of this site's Campeche Military FLIR Incident case file, whose Conventional Explanation Candidate section examines independent evidence that his sensor was most likely recording distant, stationary Bay of Campeche oil-platform gas flares rather than maneuvering craft.
U.S. Air Force Officer
A U.S. Air Force major who joined the Fry family in observing the October 24, 1950 color-cycling light over Oak Ridge, adding a trained officer's independent corroboration to a sighting that already included two civilian family members alongside a security official.
JW
U.S. Air Force F-47 Pilot
Piloted an F-47 fighter on the night of June 20–21, 1952 in pursuit of a radar- and ground-observer-corroborated white blinking light near the AEC's Oak Ridge laboratory area, climbing from roughly 10,000 to 27,000–28,000 feet without ever closing to a firing position as the object repeatedly outclimbed and outmaneuvered his aircraft. Documented directly by former Blue Book chief Edward J. Ruppelt, who noted "the pilot could see no silhouette around the light."
FS
1869 – 1942
Lieutenant, USS Supply (1904); later Admiral & Commander-in-Chief, U.S. Fleet
Born in Jerusalem, New York on January 4, 1869, Schofield graduated the U.S. Naval Academy in 1890 and was, in February 1904, an unremarkable 35-year-old lieutenant just relieved of a brief stint as acting Naval Governor of Guam. Traveling aboard USS Supply during her urgent voyage carrying the gravely ill Governor William E. Sewell toward San Francisco, Schofield arrived on the bridge after the USS Supply Aerial Phenomenon sighting was already underway, interviewed the direct witnesses, and compiled the composite account published as "Remarkable Meteors" in Monthly Weather Review. He went on to a 47-year Navy career of escalating seniority: commands of the destroyer USS Perry and battleship USS Texas, work on the Navy's General Board, authorship of War Plan Orange as head of the War Plans Division, promotion to Rear Admiral in 1924, and, from September 1931 to August 1932, service as Commander-in-Chief of the entire United States Fleet — at the time the Navy's single highest active seagoing command. He retired in 1933 after 47 years of service, died on February 20, 1942, and is buried at Arlington National Cemetery.
G
active 1904
Officer, USS Supply
An officer aboard USS Supply, identified in the surviving analytical literature on the USS Supply Aerial Phenomenon only by surname, who made a separate, contemporaneous entry describing the February 28, 1904 sighting in the ship's own deck log — a document independent of Lt. Frank H. Schofield's later composite report. Garvey's account corroborates the core phenomenon but diverges from Schofield's on one detail, recording only a west-northwest bearing rather than Schofield's stated north-northwest approach. No further biographical detail — first name, exact rank, or subsequent career — is documented in the sources consulted for this case.
DS
1891 – 1971
Chairman, Radio Corporation of America (RCA)
The RCA chairman accompanied James H. Doolittle to Stockholm in August 1946 and was briefed on Swedish radar tracks of the ghost rockets. By late September 1946 Sarnoff told the press he was "convinced that the 'ghost bombs' are no myth but real missiles," lending the phenomenon unusual credibility with the American public despite offering no technical evidence of his own.
Control Tower Chief, Teniente Luis Candelaria Airport
As the airport's tower chief on duty the night of the Bariloche sighting, García is credited across multiple Argentine accounts with corroborating the sequence of power failures, the tower's own instrument anomalies, and the sustained duration of the sighting from the ground — an institutional, on-duty vantage point distinct from either aircrew's or the more casual ground witnesses'.
GG
Photographer & Film Developer
A professional photographer and the lab technician who developed the original film roll for Amaury Rivera Toro at a pharmacy in Cabo Rojo, and the first to notice the images of the UFO and an F-14 Tomcat on the developed prints. Local researchers report Gutiérrez later admitted to assisting Rivera in faking the photographs, providing technical advice and helping set up the suspended models in Rivera's yard — his alleged confession became a key piece of evidence for skeptics.
Brothers of Antônio Vilas-Boas; Precursor Light Witnesses
Two of Antônio Vilas-Boas's brothers separately reported unexplained lights near the family farm in the days immediately preceding his claimed abduction — João on October 5 and José on October 14, 1957. Neither witnessed anything resembling a landed craft, a humanoid figure, or any element of the abduction narrative itself; their reports are, at most, corroboration that unusual aerial lights were being noticed in the area that month.
VA
Interviewed late 1990s, age 92
Cousin of João Prestes Filho
Interviewed decades later by researchers Cláudio Suenaga and Pablo Villarrubia Mauso, Alves described João's skin as "toasted, brownish, as if roasted," with twisted hands — a meaningfully less severe account than family friend Araci Gomide's. He also recalled that João had reportedly encountered "Boitatá" fireballs years earlier as a young muleteer, tying the case directly into the region's existing fireball folklore.
Nephew of João Prestes Filho (son of brother Roque Prestes)
Interviewed decades after the event, Prestes described a "ball of fire" entering through a window and burning his uncle João, and specifically maintained that João was fully lucid and had not been drinking — addressing directly the alcohol-intoxication explanation some skeptics have floated.
HF
Local Historian & Resident, Araçariguama
Interviewed by researcher Cláudio Suenaga, Fonseca confirmed the basic outline of João Prestes Filho's return from fishing and his burning upon arriving home, and separately recalled the detail of João's body being transported by cart past the local Padaria Ema bakery — a small but specific detail lending some texture of genuine community memory to the case.
GR
Active 1994–present
UAP Researcher & Skeptic
An independent researcher who proposed the "Puppet Hypothesis" as a terrestrial explanation for the Ariel School incident, arguing the children may have witnessed a traveling puppet show operated by the African Research and Educational Puppetry Programme (AREPP). His analysis focused on the visual mechanics of rod puppets, suggesting the children's descriptions of stiff necks, slow movement, and black suits matched puppets used in contemporary public-health tours.
MB
Active 1994
Playground Monitor, Ariel Primary School
The adult supervisor on duty during the recess when the incident occurred. Her decision to leave the playing field for roughly 15 minutes to fetch tea from the staff room left the children unsupervised, creating the window during which the landing occurred. She did not witness the craft or the beings herself, but observed the immediate aftermath, describing the scene as one of genuine and uncontrollable fear that spread through the entire student body.
Denver Industrialist; Named Fraud Victim
Flader's roughly $50,000 investment in Silas Newton and Leo GeBauer's "doodlebug" oil-detection device scheme, and his subsequent complaint to authorities, directly produced the October 1952 arrests that led to the pair's criminal conviction — making Flader, not any UFO investigator, the person most directly responsible for the case's formal legal resolution.
Denver Optometrist; Second Named Fraud Victim
Kleyhauer lost approximately $15,000 to a related "doodlebug" transaction with Silas Newton and Leo GeBauer. His loss, documented independently of Herman Flader's larger complaint, corroborates that the fraud scheme targeted multiple victims across the Denver business community rather than a single isolated dispute.
WW
Active 2025–present
Astronomer, Whitin Observatory, Wellesley College
Co-author with Beatriz Villarroel on the August 2025 ExoProbe MNRAS paper, and separately lead author of a January 2026 critical re-evaluation of VASCO's nuclear-test correlation and alignment statistics — a working collaborator on one project directly challenging specific claims from a related body of work, illustrating that the VASCO dispute runs through ordinary scientific channels rather than a simple insider/outsider divide.
TL
Active 1989
Witness; Bob Lazar's Wife
Accompanied her husband on at least one Wednesday-night desert observation trip in spring 1989 and was present during the period immediately following his termination from S-4, corroborating his account of intense government surveillance of the Lazar household — including vehicles parked outside their home and apparent telephone monitoring. Journalist George Knapp cited her early testimony as one factor that persuaded him to take Lazar's account seriously.
JT
Corroborating Witness; Independent Observer
A friend brought along by Gene Huff on at least one Wednesday-night observation excursion, Tagliaferri independently confirmed seeing a brightly glowing object performing unusual aerial maneuvers over the restricted desert near Papoose Lake. He had no prior connection to UFO research or to Bob Lazar's claims and no obvious motive to fabricate a shared story, extending the witness base beyond Lazar's immediate inner circle.
LW
Active 1980
Dayton, Texas Police Patrolman; Corroborating Witness
A local police patrolman who, with his wife Marie, was driving near FM 1485 on the night of December 29, 1980, and reported seeing roughly 12 double-rotor Chinook-type helicopters flying in close formation at very low altitude with powerful spotlights pointed at the ground, as if searching for something. His testimony provides independent verification that a significant, low-altitude military helicopter exercise was occurring in the area that night, contradicting official military denials.
Passenger, VASP Flight 169; Student-Photographer
Took a series of photographs of the object from her cabin window aboard VASP Flight 169 — the case's only known photographic record. A later technical reanalysis concluded the images were consistent with reflections of the aircraft's own left-wing navigation lights in nearby passing clouds rather than a distinct external object.
Passenger, VASP Flight 169
Provided one of the case's most frequently quoted descriptions, comparing the object to "a flattened chandelier, shining like mercury vapor lamps that illuminate public roads" — a vivid but ordinary-object comparison this file's own assessment notes cuts in an ambiguous direction for the case's anomalousness.
MK
Active 1975
CFS Falconbridge, Overnight Log Entry
Filed the final entry in the surviving 22nd NORAD Region log book, reporting at 07:10 GMT on November 12, 1975 that two police officers and one other witness near the base were again observing a pulsating, brilliant white light moving in a "jerky" fashion at cloud height — the last documented sighting connected to the incident before the log record ends.
22nd NORAD Region, Air Defence Group / Region Control Centre
The Region's senior operations officers, interviewed together by the press about why radar does not always confirm a UFO report. Patterson raised possible atmospheric-illusion and lenticular-cloud explanations for the visual sightings; Wooding explained the technical differences between search and height-finder radar and the conditions under which a real target can be missed by one set while registering on another.
FG
Farm Resident, Carman Area
Reported a UFO sighting east of her farmhouse directly to the RCMP on July 7, 1975, one of the many individual, dated farm-family reports preserved in the National Research Council files that researcher Chris Rutkowski later catalogued from the broader 1975 Manitoba wave.
Subcontractor Witnesses (2007)
The three framing subcontractors who accompanied Chris Bledsoe and his son gave MUFON investigators substantially consistent independent descriptions of the orange lights, the larger luminous object, and the red-eyed presence in the tree line. None had any prior UFO-research background or any documented motive to fabricate a shared story with their employer.
VA
Active 1964
Bow Hunter & Corroborating Witness
One of Donald Shrum's hunting companions, lost on a neighboring ridge during the night of September 4, 1964. Alvarez observed a red, glowing light performing rapid, non-ballistic maneuvers over the forest canopy, providing independent corroboration of anomalous aerial activity, and witnessed the physical evidence of Shrum's damaged arrows and burned clothing the following morning.
TT
Active 1964
Bow Hunter & Corroborating Witness
Donald Shrum's second hunting companion. While Trueblood did not witness the lights or entities directly, he participated in the search for Shrum and witnessed his physical and emotional state upon reunion at dawn, as well as the recovery of physical evidence at the tree site.
Investigating Officer, Royal Australian Air Force (Directorate of Air Force Intelligence)
The RAAF officer who interviewed Father William Booth Gill in person on December 29, 1959 — six months after the Boianai sighting, and without traveling to the site or interviewing any other witness. His written assessment found Gill "reliable" while suggesting the lights "could have been nothing more than natural phenomena," an assessment neither fully endorsed nor fully rebutted by the department's own final internal conclusion two months later.
VK
Active 1986
Dalnegorsk Resident, Primary Eyewitness
Among the most frequently quoted eyewitnesses in secondary accounts of the case, Kandakov estimated the object's altitude at 700–800 meters and its speed at roughly 15 meters per second, describing its gradual ascent and descent and the "jerking" motion immediately before it fell onto Height 611 — the single detail most cited against a simple meteor explanation.
VK
Active 1986
Editor, Trudovoye Slovo (Local Dalnegorsk Newspaper)
As editor of the town's own newspaper, Korotko was positioned to gather and cross-check local witness accounts in the immediate aftermath of the sighting, helping establish that the object had been seen simultaneously from multiple points across Dalnegorsk rather than by an isolated individual or small group.
VH
Active 1965
Independent Corroborating Witness; Reporter, Haverhill Gazette / UPI Stringer
A professional local journalist with no connection to the police officers or Norman Muscarello, Hale separately observed the object's high-speed departure the same night and judged its speed and apparent size inconsistent with a Strategic Air Command B-47 bomber, offering an independent, professionally informed assessment that aligned with the police officers' account.
Independent Civilian Ground Witnesses, Charles Mill Lake / Mansfield Vicinity
A woman identified in investigator Jennie Zeidman's report as "Mrs. Erma C.," driving on Route 430 with several children, and separately the Elias family southeast of Mansfield — including 14-year-old John Elias, awakened by green light in his bedroom — independently reported observing the green-illuminated helicopter and, in the "Erma C." family's case, the object itself, described as resembling a blimp or a school bus in size. Neither family had contact with the flight crew before investigators connected their accounts.
JB
Active 1950
Employee, Perry Smoak Garage, Farmington
Described the objects' speed as roughly ten times that of a jet plane and a specific, repeated right-angle-turn maneuver as pairs of objects appeared to pass and overtake one another. No source consulted preserves further biographical detail beyond his name and workplace.
LS
1907 – 2005
Primary Visionary; later Carmelite nun (Sister Lucia of Jesus)
The eldest of the three Fatima shepherd children and the only one to survive past 1920, Lucia was the primary source for the apparitions' reported content, including the announcement of an October "miracle." Her earliest 1917-era depositions are comparatively spare; her far more detailed later memoirs, written from the 1930s onward under Church guidance, are the source of most of the narrative and theological detail associated with the case today. She died in 2005 at her Carmelite convent in Coimbra, Portugal, at age 97.
FM
1908–1919 (Francisco); 1910–1920 (Jacinta)
Co-Visionaries, Fatima; canonized 2017
Lucia dos Santos's younger cousins, aged 9 and 7 respectively in October 1917, were present throughout the apparitions and the solar event. Both died within three years of the influenza pandemic that swept Portugal at the close of the First World War, and so left no adult retrospective testimony comparable to Lucia's later memoirs.
AA
Chief Editor, O Seculo (Lisbon); eyewitness journalist
A senior figure at Portugal's largest and editorially anticlerical daily newspaper, Almeida arrived at Cova da Iria expecting to document a failed prophecy and instead published a front-page eyewitness account, on October 15 and again on October 17, 1917, describing the crowd witnessing the sun's unusual behavior. His institutional position — a hostile secular journalist with no devotional incentive to embellish — is the single fact most frequently cited by researchers on both sides of the case. He later converted to Catholicism, dying in 1932.
Ophthalmologist; correspondent, Ordem
A trained eye physician present at Cova da Iria who wrote his own account for the periodical Ordem, specifically noting he was able to look directly at the dimmed solar disc without the pain a healthy eye normally experiences staring at the sun — a clinically informed observation cited by researchers on both sides of the debate over what physically happened to the sun's apparent brightness that day.
NN
Active 1952 (age 14)
Civilian Witness
A 14-year-old local schoolboy and close friend of the May boys, Nunley was the witness who first spotted the entity's glowing red eyes in the oak tree, and noticed the strong metallic smell in the air during the climb up the hill. He described a massive, floating shape with a spade-shaped hood and dark green body, and suffered eye irritation and throat swelling after the encounter; his testimony was cited as key evidence by Project Blue Book and civilian researchers alike.
EM
Active 1952 (age 13)
Civilian Witness
The 13-year-old son of Kathleen May, Edward ran home to alert his mother when the fireball appeared and joined the search party, describing the entity as a towering, metallic figure that hissed like steam. He was particularly traumatized, experiencing nightmares, nausea, and mild convulsions that night; his account, recorded by editor A. Lee Stewart Jr., was used to compile the first drawings of the creature.
FM
Active 1952 (age 12)
Civilian Witness
The 12-year-old brother of Edward and youngest member of the group, Fred witnessed the fireball land and accompanied his mother and brother up the hill, describing a red, glowing sphere pulsing in the darkness and the sweet, metallic odor that filled the air. He suffered throat swelling, vomiting, and a high fever for several days after the sighting; his testimony was collected by Gray Barker and Ivan T. Sanderson.
AS
Local Newspaper Editor & Investigator
Editor and co-owner of the Braxton Democrat, Stewart was the first investigator to arrive at the May home, within thirty minutes of the encounter, interviewing the witnesses while they were still in a state of shock. He returned to the hill that night with Eugene Lemon, noting the lingering chemical odor, and the next morning discovered the oily skid marks and depressed grass, documenting the physical traces and publishing the first detailed report of the incident.
RM
Active 1951
Radar Operator, SCR-584 Set, Fort Monmouth
One of the operators who tracked the separate September 11, 1951 SCR-584 contact, Meyer judged the target's radar signature consistent with a "B-29 size" aircraft and stated it was not a balloon — a data point the original 1951 investigators themselves treated as insufficient, on its own, to reach any firm conclusion.
RM
Active 1978
Ground Witness / Photographer
A civilian tourist photographing the sunset at Cape Otway on the evening of October 21, 1978, shortly before Frederick Valentich's flight. One of his photographs shows a dark, anomalous shape rising from the water near the lighthouse with a light trail behind it; ufologists and photographic experts who analyzed the negative concluded it showed a fast-moving, structured object, though skeptics suggest a bird or dust on the lens.
RR
Active 1978
Girlfriend of Frederick Valentich
Interviewed extensively by Victoria Police and accident investigators, Rushton confirmed that Valentich was in good spirits, excited about his flight training, and showed no signs of stress or unusual behavior — testimony that helped investigators rule out personal distress or relationship issues as a motive for a staged disappearance or suicide, supporting the credibility of a genuine flight emergency.
AC
Then-Comandante, Aide-de-Camp to Gen. Dolz Espejo
Aboard the same T-12 Aviocar as Gen. Dolz Espejo, Ruiz Crespo gave a closely matching account of a bright, cylindrical light that expanded and lost intensity as the aircraft approached Gando. Interviewed by researcher Ricardo Campo Pérez in January 1995, by then a retired colonel, he was unambiguous in hindsight: "that thing had nothing to do with a UFO."
Captain, Iberia Boeing 727, Flight IB-562
Flying the scheduled Málaga–Tenerife route, Palacín initially misjudged the phenomenon as only a few hundred meters from his aircraft before his own radar check, returning no contact, forced him to concede his distance and size estimates were badly wrong — a rare piece of testimony in which a trained professional witness explicitly corrected his own real-time misperception once instrumentation contradicted it.
BM
Active 1954
Tradesman, Vernon, Eure, France
A 25-year-old Vernon businessman who reported a large cigar-shaped object releasing five smaller discs over the Seine in the early hours of August 22–23, 1954 — one of the wave's earliest well-documented reports, corroborated the same night by two police officers and an army chemical engineer traveling nearby. A period newspaper account separately noted, skeptically, that Miserey had "a strong imagination well known in the region."
GG
Active 1954
Construction Foreman, Marcilly-sur-Vienne, Indre-et-Loire, France
Foreman of an eight-man masonry crew who reported a close-range encounter with a small, helmeted humanoid figure and a hovering, glowing dome-shaped object on September 30, 1954. His account was corroborated in general shape by his seven co-workers, all of whom subsequently reported headaches, appetite loss, and insomnia.
ET
Active 1954
SNCF Railway Inspector, near Boulogne-sur-Mer, Pas-de-Calais, France
A 34-year-old railway inspector who photographed a disc-shaped object twice near Ambleteuse on October 24, 1954, while photographing an unrelated Neolithic tomb. His two images remain among the wave's most-reproduced amateur photographs, of unresolved authenticity.
Confessed Hoaxers, Bélesta, Ariège, France
A group of local young men who staged the October 16, 1954 Bélesta "luminous spheres" display using a lamp-fitted bicycle wheel, fork, and handlebars, and who publicly confessed to the hoax in regional press coverage 55 years later, in 2009 — a rare case in this wave with a confirmed, on-record admission rather than an inference either way.
BW
Chief of Police, Ashland, Nebraska (1967)
Herbert Schirmer's commanding officer, Wlaschin confirmed that Schirmer passed a polygraph test regarding the sighting, personally visited the highway junction the same morning, and recovered the small metallic fragment later forwarded to the Condon Committee for laboratory analysis. His institutional backing of Schirmer — including naming him chief shortly afterward — is one of the case's stronger circumstantial credibility indicators.
AB
1924 – 1998
Primary Witness / Master Mechanical Engineer / Automotive Importer
Beers, who wrote under the pseudonym Stefan Denaerde, was the sole witness to the physical encounter inside the reported USO. A respected member of the Dutch business community importing heavy vehicles and machinery, his technical training allowed him to document the craft's engineering and the planet's atmospheric physics with a high degree of precision. He maintained the truth of his account until his unexpected death in 1998, refusing to profit from the story.
MB
Active 1965
Corroborating Witness / Spouse
Miriam Beers was aboard the steel tjalk sailing vessel when the collision occurred in the Oosterschelde. She witnessed the sudden stop of the boat, the erratic behavior of the compass, and the intense blue light that illuminated the yacht. While she did not enter the reported vessel, she confirmed the physical reality of the submerged object and the presence of figures in the water, supporting her husband Adriaan's account during private investigations.
Chief of Surgery, Rio de Janeiro Hospital
Together with family members, reported an independent sighting of a Saturn-shaped object off the Brazilian coast toward Trindade at roughly 2:30 A.M. on January 16, 1958 — less than ten hours before the Barauna photographs and unconnected to them at the time of the report.
FH
Active 1969
Corroborating Witness; 1969 President, Leary Lions Club
The only Leary resident located by a 1976 field investigation who recalled the evening at all. His recollection was faint and non-specific — "a blue light or something ... like some kind of weather balloon" — offered as his own tentative guess rather than a confirmed identification. His account corroborates that something was seen that night by more than Jimmy Carter alone, but adds little independent detail.
GL
Active 1955
Farmhouse Matriarch
The fifty-year-old widowed mother who managed the household, Lankford was highly respected for her integrity and religious beliefs. She testified consistently to the reality of the entities and the terror of the shootout, resisting any media exploitation.
ES
Korean War Combat Veteran
Glennie Lankford's twenty-six-year-old son, who actively defended the home with a 20-gauge shotgun. His weapons experience and combat background add substantial weight to his testimony regarding the creatures' apparent bullet-resistance and movement characteristics.
BT
Active 1955
Civilian Experiencer / Visitor
The visitor from Pennsylvania who first saw the craft landing and had close physical contact with a creature reaching from the roof. His accounts remained consistent through extensive investigations.
RG
Hopkinsville Police Chief
The senior law enforcement official who received the family at the station and coordinated the multi-agency response. He verified the family's extreme state of shock and terror, indicating their experience was genuine.
Ceduna Police
The two officers who formally inspected the Knowles family's vehicle and interviewed them at Ceduna. Fennell told United Press International the family "were extremely distraught" and confirmed the ash and roof damage himself; Hagen's statement that "we think there could be something in this" is one of the case's most-quoted lines, reflecting the seriousness with which local police treated the report.
Pilot, Geographer & Topographer, IGN Survey Crew
The remaining three crew members aboard the Aero Commander 680 during the September 4, 1971 survey flight. None reported observing the object during the flight; their significance to the case is entirely retrospective, as government professionals present for a mission whose only anomaly was discovered after the fact in the darkroom, not in the air.
CZ
Active 1974
Brother-in-law of Edwin Fuhr
Reported to have telephoned the Langenburg RCMP detachment on the day of the sighting to ask whether any other UFO reports had been received — a small piece of independent, same-day corroboration that a second family member was reacting to the story before any press coverage existed.
Scene-of-Crime Officer, Lothian and Borders Police
The officer who personally located, photographed, and measured the ground marks in the clearing using Robert Taylor's directions, hours after the encounter. Wark independently checked the Livingston Development Corporation's forestry machinery against the marks and confirmed no aircraft had been operating in the area, finding no conventional explanation for what he documented. He later rose to Detective Inspector before retiring.
MD
Active 1979
Robert Taylor's Supervisor, Livingston Development Corporation
Taylor's immediate work supervisor, who was initially skeptical of the account but visited the clearing himself and reported finding "very pronounced indentations" in the ground consistent with what Taylor described — a shift toward guarded acceptance from a witness with a direct professional relationship to Taylor and no obvious motive to validate an implausible story.
CG
Police Commissioner, Onnaing/Valenciennes district
The police commissioner who traveled to Marius Dewilde's home the morning after the first encounter, took his formal statement, and personally observed him "trembling in all his limbs" and suffering intestinal contractions — a physical state Gouchet's own account cites as evidence against a calculated hoax. It was Gouchet who alerted French air police, setting the physical-trace investigation in motion within roughly a day of the report.
ES
United Airlines Pilot; Second Opinion
A working commercial airline pilot and independent July 4, 1947 UFO witness whom Kenneth Arnold recruited in Tacoma to help assess the Maury Island debris. Smith's professional judgment that the material was unremarkable reinforced Arnold's own growing suspicion that the story did not hold together.
JB
Active 1951 (age 30)
Pilot in Command, East African Airways (former BOAC pilot)
Bicknell gave the primary, most detailed, and earliest account of the Mount Kilimanjaro sighting, radioed a contemporaneous report while the object was still visible, and personally arranged for all nine passengers to sign a sworn statement before landing — a same-day corroboration procedure this case file treats as a genuine and unusually strong credibility signal.
DM
Radio Officer, East African Airways (former RAF)
Merrifield was, by most accounts, the first crew member to spot the object and the one who alerted Capt. Jack Bicknell, making him this case's original witness. His considerably longer service background relative to Bicknell's own gives this case two independently credentialed aviation professionals of different generations rather than a single voice.
HF
Passenger; American Businessman (Sporting-Goods Dealer)
Fussell examined the Mount Kilimanjaro object through marine binoculars he happened to be carrying and provided one of the more detailed physical descriptions, including the object's "sausage" shape and vertical markings. His still camera produced only one indistinct frame among several blank exposures.
RO
Active 1951
Passenger; American Radio Officer, Merchant Freighter Robin Mowbray
Overstreet shot roughly thirty feet of color cine film through a telephoto lens — the only photographic record of the Mount Kilimanjaro case ever confirmed to show anything — and personally brought his story and film to the Natal Mercury in Durban after continuing on to South Africa. The film itself has never been recovered; a single frame reproduced in the newspaper's March 14, 1951 edition was rediscovered by researcher Barry Greenwood only in 2015.
JR
Adult Resident, Kelso — Named Witness to the July 23 Sighting
One of the few named adult witnesses at Kelso, reported alongside the schoolchildren in contemporary Otago Daily Times coverage of the July 23, 1909 daylight sighting.
JB
Active 1909
Resident, Kaitangata — The Wave's Opening Witness, July 11, 1909
Publicly named on July 29, 1909 by the Bruce Herald as the source of the wave's opening report on July 11, describing a light bobbing over the Wangaloa Hills that moved "with as much ease, and even grace, as a bird on the wing."
RG
Active 1909
Surveyor, Balclutha — Author of an Early Published Extraterrestrial-Hypothesis Letter
A professionally trained surveyor whose July 29, 1909 letter in the Clutha Leader proposed the sightings represented a "visitation from another world" and urged a government search using searchlights and wireless telegraphy — described by researcher Bryan Dickeson as among the earliest published newspaper proposals of non-human origin for an aerial phenomenon.
FG
Active 1909
Dredge Winchman, Waikaka Valley, near Gore
Reported a narrow, boat-shaped craft with two apparent occupant figures near the Syndicate No. 2 dredge in the early morning hours in late July or early August 1909, including a claimed moment of the object's propeller reversing before a sharp turn.
CB
Active 1909
Resident, Taylorville, near Whanganui — Independently Corroborated Sighting
Reported a well-lit airship traveling from Maxwell in the early hours of August 11, 1909, a sighting independently corroborated by a milkman making his own rounds nearby — one of the wave's few genuinely independent two-witness corroborations outside Kelso.
Royal Danish Navy, HDMS Willemoes
Commanding officer of the Danish destroyer Willemoes during the September 13, 1952 sighting. Jensen and his crew observed a triangular, bluish-glowing object traveling at an estimated 900+ mph, confirmed by the ship's own radar — one of the few radar-visual cases from the Mainbrace exercise. As a destroyer commander familiar with the radar signatures of aircraft, missiles, and maritime traffic, his assessment of the object as anomalous carries particular weight.
WL
Active 1952
Civilian Photographer, USS Franklin D. Roosevelt
A professional photographer aboard the aircraft carrier to document Operation Mainbrace. When a silvery, spherical object was sighted on September 20, 1952, Litwin captured a series of color photographs on professional equipment; Navy intelligence examined them, but they have never been publicly released. Some of Litwin's Mainbrace-related materials are held in the Wallace Litwin Collection at East Carolina University.
SS
Named Witness, Wurtsmith AFB (Duty Position Not Specified in Sources Consulted)
Identified by rank and name in the surviving secondary compilations of the Oscoda AFB sighting, without a specified duty position in any source this case file's research located. Presented here honestly as an additional named witness rather than with an invented role.
FD
Jackson County Sheriff
The lead law enforcement investigator who questioned Charles Hickson and Calvin Parker on the night of October 11, 1973. Although initially skeptical, Diamond was convinced of the men's sincerity after reviewing the secret audio tape recording. He coordinated the subsequent investigation, contacting military authorities at Keesler Air Force Base and ensuring the men received medical scans, and his administrative support was critical in preserving the original police records and the secret recording for later scientific review.
MB
Came forward 2019
Secondary Eyewitness
Came forward in 2019 with independent corroboration of the encounter, stating that on the evening of October 11, 1973, while sitting in a vehicle near the Pascagoula River waiting for her husband, she witnessed a bright, blue flashing light and a hovering craft near the Frito-Lay grain elevator at the exact time Hickson and Parker reported being abducted. Her signed statement was reviewed by researchers who noted her description matched the primary witnesses' accounts closely.
MM
Active 1954
Officer, Petare Transit Inspectorate
One of two Transit Police officers who took Gustavo González's and José Ponce's statements at approximately 2:30 AM, within minutes of the reported encounter. The surviving record credits Moreno and his colleague with noting that neither man appeared intoxicated or mentally disturbed — a contemporaneous, disinterested observation that remains the case's strongest single piece of documentary corroboration.
ED
Active 1954
Officer, Petare Transit Inspectorate
Co-signed the same-night police statement alongside Manuel Moreno, jointly documenting the witnesses' report and demeanor within roughly half an hour of the encounter's reported end.
JG
Physician, Hospital Pérez de León, Petare
A corroborating secondary witness who reported hearing a scream or cry of terror from the direction of Buena Vista Street at approximately the time of the encounter, independently supporting that something distressing was audible in the neighborhood that night, without claiming to have witnessed the entity or craft directly.
JY
Senior Officer, Petare Transit Police
A more senior police official who reviewed the witnesses' report and is recorded as characterizing the incident as "extremely unusual," reflecting the department's own genuine surprise at the account rather than a routine dismissal.
JW
Representative, New York UFO Research Society
Traveled to or corresponded with investigators in Venezuela in the weeks following the encounter and proposed hypnosis and sodium pentothal testing to further probe Gustavo González's memory of the event — a proposal González ultimately declined.
AC
Active 1954
Manager, National Sausage Industry (Schefer) Plant
Gustavo González and José Ponce's employer, who vouched for both men's character to investigators and reporters, describing them as serious, hard-working, and reliable employees with no history of erratic behavior — testimony offered specifically to counter skepticism about the men's fantastic story.
VB
Active 1977
Former Military Pilot
A former pilot among the civilian eyewitnesses cited in the Academy of Sciences' compiled Petrozavodsk case file; his aviation background was noted by investigators as relevant to assessing the reliability of his description of the object's flight characteristics.
Independent Corroborating Witness; Conway, Pennsylvania Police Department
Panzanella had already been observing the object from an Atlantic service station in Conway for roughly thirty minutes before the pursuing Ohio officers arrived, giving the case its fourth, entirely independent professional witness in a second state. Overwhelmed by press inquiries afterward, he disconnected his home telephone but never recanted his account.
WS
1910 – 1962
Senior Radio Engineer, Department of Transport; Founder and Director of Project Magnet
A senior Canadian government radio engineer whose September 1950 conversation with Robert Sarbacher in Washington convinced him flying saucers were a legitimate, highly classified research subject. Smith's own November 1950 proposal led to Project Magnet's formal approval, and he directed the program's instrumented UFO-detection research through its 1954 conclusion. He later moved into more explicitly esoteric writing about claimed extraterrestrial contact, published posthumously in 1969.
OS
Chairman, Defence Research Board
Reviewed and endorsed Wilbert Smith's November 1950 Project Magnet proposal on behalf of the Defence Research Board before it was formally approved, offering the Board's scientific cooperation.
PM
Active 1952–1954
Astronomer, Dominion Observatory; Chairman, Project Second Storey
Chaired the Defence Research Board's parallel and considerably more skeptical review committee from 1952 to 1954, ultimately concluding UFOs were "not amenable to scientific inquiry" and recommending an end to further government investigation — a documented institutional counterweight to Wilbert Smith's own contemporaneous conclusions.
RS
Active 1950–1983
Consultant, U.S. Department of Defense Research and Development Board
Sarbacher's September 15, 1950 conversation with Wilbert Smith in Washington, D.C. — in which he reportedly confirmed flying saucers were real and the subject highly classified — is documented context for Smith's motivation heading into his Project Magnet proposal. Broadly corroborated by Sarbacher's own later 1983 letter to researcher William Steinman, though Sarbacher there also described his personal knowledge as second-hand.
MP
Active 1977
Corroborating Witness — Mother of Lee Parrish
Played a vital role in the immediate aftermath of the encounter, documenting her son's physical symptoms, including his bloodshot eyes and extreme light sensitivity, and establishing the timeline of his 45-minute missing time. Her concern for her son's well-being led her to contact professional investigators, initiating the documentation of the case.
KJ
Active 1977
Corroborating Witness — Girlfriend of Lee Parrish
The last person to see Lee Parrish before the encounter, confirming that he left her home in Harrods Creek at 12:50 AM on January 27, 1977, in a normal, sober, and relaxed state of mind. Her testimony established the baseline start time for the case's spatiotemporal gap.
LA
Active 1977
Hypnotist — Louisville, Kentucky
The professional hypnotist who conducted Lee Parrish's regression sessions, using conservative, clinical induction techniques to ensure the integrity of the recovered memories, avoiding leading questions and prioritizing the witness's psychological safety. His recordings serve as the primary audio archive of the regression sessions.
BM
APRO Consultant — Biology Professor
Conducted the field investigation for the Aerial Phenomena Research Organization (APRO). Monroe located independent children witnesses who observed the orange-red rectangular craft and documented the automotive repair records, providing corroborative evidence of the case's physical reality.
Laborer / Estate Manager, Kirillo-Belozersky Monastery Lands near Loza — Author of the Original Memorandum
A monastery employee, not himself a witness to the phenomenon, who took the documented step of personally verifying peasant Levka Fedorov's account and separately obtaining written confirmation from the local district's parish priests before forwarding the full memorandum to his monastic superiors. His own report is the sole surviving primary source for the entire Robozero incident, first published in 1842, nearly 180 years after it was written.
Peasant — Primary Named Eyewitness
Identified in the original 1663 memorandum as the peasant whose direct account of the phenomenon was relayed and cross-checked by Ivan Rzhevsky. No further biographical detail survives in any source located beyond his name and his role as the report's original eyewitness source.
Independent Civilian Witnesses
Driving a separate stretch of Highway 3 at the same time as Laurie Wickens, Smith (18) and Kendrick independently observed the same descending lights over Shag Harbour, corroborating the primary account without any prior contact with Wickens's group.
Local Fishermen
Launching boats from the Government Wharf within the hour of the Shag Harbour sighting, Shand and Smith were the first to find the thick, sulphur-smelling yellow foam patch on the water and searched for nearly an hour without finding any survivors or debris — experienced mariners whose judgment that the foam was unusual carries real weight given their intimate familiarity with those waters.
Air Canada Flight 305 Flight Crew
Reporting a lit, rectangular object and two "silent explosions" beginning around 7:15 PM, roughly four hours before the main Shag Harbour event, this professionally trained aircrew's account may or may not describe the same phenomenon that later descended at Shag Harbour — a connection this file treats as plausible but unconfirmed.
WC
1874 – 1965
First Lord of the Admiralty — Formally Confirmed the Sheerness Sighting in the House of Commons
Then a Liberal Cabinet minister and head of the Royal Navy, Churchill gave the House of Commons its fullest account of the October 1912 Sheerness incident on November 27, 1912, confirming an "unknown aircraft" had been present and was "not one of our own airships," while declining to name a nationality publicly. Privately, before the Committee of Imperial Defence on December 6, he stated he had "very little doubt" the aircraft was German — a materially more definite private assessment than his public statement.
Conservative Member of Parliament — Raised the Sighting in the Commons
Put the first parliamentary question about the Sheerness sighting to the Secretary of State for War on November 18, 1912, asking specifically whether "a Zeppelin dirigible" had passed over the dockyard, and pressed Winston Churchill further on relative British and German airship capability during the fuller November 27 debate.
JS
Secretary of State for War — First Government Response to the Sighting
Responding to William Joynson-Hicks's initial November 18, 1912 question, Seely stated the War Office had "communicated with the Admiralty" and had "no definite information" confirming or denying the sighting, a notably more cautious response than Churchill's own fuller statement nine days later.
SC
Sergeant, New Mexico State Police
The first secondary officer to arrive at the arroyo, within two minutes of Lonnie Zamora's radio transmission. Chavez found Zamora pale, sweating, and visibly shaken, and together they walked into the ravine and documented the physical evidence: the actively smoking creosote bushes and the four deep, V-shaped footprints — corroboration that established the physical evidence was fresh and could not have been staged by Zamora alone.
OG
Active 1964
Service Station Owner, Socorro
Owner of a service station on the north side of Socorro who testified that at approximately 5:45 PM on April 24, 1964, a couple from Colorado stopped to refuel and mentioned observing a very low-flying, egg-shaped object or helicopter with a bright flame flying south along the highway, with a police car appearing to pursue it — independent civilian corroboration of a low-flying object in the sector at the exact time of Zamora's sighting.
KG
Civilian Witnesses, Socorro
Two local residents working near the cemetery south of Socorro on the afternoon of April 24, 1964, who reported hearing a loud, roaring sound and seeing a bright blue-orange flame in the sky to the southwest at approximately 5:45 PM — auditory and visual reports that match the timeline and description of the craft's liftoff, though they did not see the craft on the ground.
MW
Active 1964
Civilian Witness, Socorro County
A local resident driving along a dirt road west of the mesa at approximately 5:48 PM on April 24, 1964, who reported seeing a shiny, egg-shaped object flying silently to the southwest at low altitude, with no visible wings, tail fins, or propellers. His report aligns closely with the departure vector and velocity Lonnie Zamora described, providing independent verification of the craft's flight path after leaving the arroyo.
Cumberland Constabulary CID Officer
Told The Cumberland News in 1964 that he had "no knowledge whatsoever" of the "men in black" visit Jim Templeton had described in connection with the Solway Firth spaceman photograph — the strongest contemporary evidence against that specific strand of the story being a genuine official visit.
DM
1908 – 1997
Art Collector and Patron; First Institutional Preserver of the Dellschau Notebooks
The Houston-based Schlumberger heiress and major 20th-century art patron who purchased the earliest four Dellschau notebooks in 1969 for $1,500 and exhibited them almost immediately, effectively rescuing the collection from further dispersal and establishing Charles Dellschau's place in the outsider-art canon.
PN
Active 1972–present
Graphic Designer and Self-Taught Researcher; Principal Cipher Investigator
Purchased eight additional Dellschau notebooks in 1972 and spent roughly three decades trying to decode Dellschau's approximately 40-symbol cipher alphabet, claiming to have identified the phrase "NYMZA" embedded in the coded text. Navarro has never published a complete translation key, so his central decipherment claims remain unverifiable by outside researchers.
WS
Active present
Menil Collection Researcher; Author of the Most Complete Dellschau Biographical Chronology
A frame conservator and researcher for the Menil Collection who compiled the most rigorous documentary chronology of Charles Dellschau's actual, verifiable life — explicit that he has been unable to place Dellschau in California during the 1850s despite dedicated searching, while still regarding significant portions of the artist's later, better-documented Texas biography as credible.
EB
Active 1999-2000
Lebanon Police Department
The first officer to respond to dispatch, initially skeptical, who reported the most dramatic single account of the night: a massive triangular object executing a flat, non-banking pivot and an apparent near-instant multi-mile relocation toward Shiloh. His report near Summerfield set the rest of the night's chain of sightings in motion.
DM
Active 1999-2000
Shiloh Police Department
Independently reported an "extra-wide triangle or arrowhead" with an irregular, blocky underside, a timestamp preserved on the FOIA'd CENCOM dispatch log. His description of the object moving "in the snap of a finger" closely echoes the extreme motion Ed Barton had reported minutes earlier from a different location. The Shiloh historical marker commemorating this case is built directly around his report.
CS
Active 1999-2000
Millstadt Police Department
Observed the object from an open field near Liederkranz Park, reporting a concave-rear arrowhead shape, a low-frequency buzzing sound, and taking the case's only photograph — a single ambiguous Polaroid showing blurred points of light rather than a resolved shape.
MJ
Active 1999-2000
Dupo Police Department
Observed lights through binoculars at an estimated 20,000–30,000 feet — commercial-airliner altitude — directly contradicting the low-altitude estimates given by the other officers who reported the St. Clair County triangle. This site's research treats Jany's account as the case's single most important complicating detail.
ML
Active 1999-2000
O'Fallon Police Department
The fifth and final on-duty officer identified as an independent witness, per investigator Darryl Barker's own case files. Reported amber lights in two fixed rows, larger than a C-5 or 747's wingspan, that never changed their relative position to him as they receded.
MN
Active 1999-2000
Civilian; Owner, Fun Land Miniature Golf Course, Highland, IL
The night's first witness, whose roughly 4:00 a.m. report to St. Clair County dispatch of a large, brightly lit object resembling "a flying house" set the entire chain of subsequent officer sightings in motion.
HK
Active 2011
Independent VFX Analyst & Debunker
The pseudonymous YouTube channel that published the first comprehensive forensic breakdown of the 2011 Temple Mount footage, identifying the Motion Tile border artifacts, static background pixels, and pre-scripted audio cue timing. Their analysis was subsequently confirmed by CBS News, Fox News, and multiple mainstream media investigative teams, and remains the definitive technical debunk of the incident.
AP
Active 1966
Property Owner, Horseshoe Lagoon, Euramo
The cane farmer on whose land the Tully sighting and nest occurred. Pennisi did not witness the object but corroborated the discovery of the trace and reported experiencing a week of recurring dreams about a dish-shaped object landing near his property in the days immediately preceding the sighting. He continued to document recurring nests at the same lagoon for more than two decades.
AM
Investigating Officer, Tully Police
The first official investigator on the scene, Moylan examined the nest the morning after the sighting, initially floated and then set aside a small-helicopter explanation after noting more suitable open land nearby, and formally referred the case to RAAF Base Townsville.
Chief, Requirements Intelligence, AC/AS-2; requested the AMC opinion
Headed the Requirements Intelligence branch of Army Air Forces intelligence in 1947 and formally requested Air Materiel Command's technical appraisal of the flying disc reports on July 30, 1947 — the specific request Twining's memo answers. Schulgen had separately sought FBI assistance investigating early disc witnesses out of suspicion the reports might reflect hysteria or a Soviet psychological operation, a suspicion Twining's memo directly and explicitly rejected in its opening finding.
Director of Research and Development, HQ USAF; authorized Project Sign
Formally authorized the "detailed study" Twining's memo had recommended on December 30, 1947, converting a command-level recommendation into an actual funded, staffed program — the single administrative act that turned the memo from an internal opinion into the direct cause of Project Sign.
BY
Active 1989
Former Pilot; Adult Corroborating Witness
Identified by name in Jacques Vallee's field summary as one of roughly forty adult witnesses in the neighborhood around Voronezh's Yuzhny Park who reported aerial activity on the evening of September 27, 1989. As a former pilot, Yatsunov represents the case's most professionally relevant adult observer, though his account is understood to describe lights or an aerial object rather than the landing or entities themselves.
MS
Active 2005–present
Son of Capt. William Schaffner
The pilot's youngest son, who traveled to the Ministry of Defence's Main Building in London in 2005 to personally read the declassified Board of Inquiry report — among the first family members to see the official account of his father's death. His and his brothers' cooperation with subsequent researchers, including author John Nichol, has been central to reconstructing an accurate account of the case grounded in fact rather than tabloid myth.
DJ
Active 1975
Forestry crew member, witness
Member of the seven-man wood-thinning crew who witnessed the object at Turkey Springs and searched for Travis Walton after the beam strike. One of the crew members who sat for Cy Gilson's official polygraph examination on November 10, 1975. The least individually documented of the seven, with no further biographical detail located beyond his name and crew role in any source consulted for this case file.
CB
Active 2007 (then age 17)
Sighting Witness (2007); son of Chris Bledsoe Sr.
Present for the entire January 8, 2007 fishing trip and independently reported encountering two small entities near the riverbank while searching for his father, describing a sensation of temporary paralysis while hiding in low brush and watching the figures pick up trash and bottles nearby. His account of the missing-time discrepancy corroborates his father's, though as an interested family member his testimony cannot be considered fully independent.